KEGG   Loxodonta africana (African savanna elephant): 100653679
Entry
100653679         CDS       T04351                                 

Definition
(RefSeq) tubulin beta-2A chain isoform X2
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100653679
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100653679
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100653679
   05012 Parkinson disease
    100653679
   05014 Amyotrophic lateral sclerosis
    100653679
   05016 Huntington disease
    100653679
   05020 Prion disease
    100653679
   05022 Pathways of neurodegeneration - multiple diseases
    100653679
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100653679
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100653679
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100653679
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100653679
  Exosomal proteins of colorectal cancer cells
   100653679
  Exosomal proteins of bladder cancer cells
   100653679
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100653679
NCBI-ProteinID: XP_003417907
UniProt: G3THJ3
LinkDB
Position
Unknown
AA seq 445 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcgtgaaatcgtgcacatccaggcgggccagtgcggcaaccagatcggcgccaagttt
tgggaggtcatcagtgatgagcatggtatcgaccccactggcagttaccatggcgacagt
gacttgcagctggagagaatcaatgtctactacaatgaagctgctggtaacaaatacgta
cctcgggccatcctggtggatctggagcctggcaccatggactcagtcaggtctgggcca
tttggccagatcttcaggccagacaacttcgtctttggccagagtggtgccggcaataac
tgggcaaagggccactacacagagggagcagagctggtggactccgtgctggatgtggtg
aggaaggagtctgagagctgtgactgtctccagggcttccagctgacccactcgctgggg
ggtggcacggggtccgggatgggcacgctgctcatcagcaagatcagggaggagtacccc
gaccgcatcatgaacaccttcagcgttatgccttctcccaaggtgtcagacaccgtggtg
gaaccctacaatgccaccctctctgtccaccagctggtggagaacaccgatgaaacctac
tctatcgacaatgaggccctgtatgatatatgtttccgcaccctgaaactgaccaccccc
acatatggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgtttcccaggccagctgaatgcagacctccgcaaactggccgtgaatatggtgcccttc
ccccggctgcacttcttcatgcccggctttgcccccctgaccagccggggcagccagcag
taccgggccctgaccgttcctgagctcacccagcagatgttcgactccaagaacatgatg
gctgcctgcgacccccgccatggccgctacctgacggtggccgccatcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccaccccgcggc
ctcaagatgtccgccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcaccgccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgacgagcaaggggagttcgaggaggaggag
ggcgaggatgaggcttaa

KEGG   Loxodonta africana (African savanna elephant): 100656057
Entry
100656057         CDS       T04351                                 

Gene name
TUBB1
Definition
(RefSeq) tubulin beta-1 chain
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100656057 (TUBB1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100656057 (TUBB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656057 (TUBB1)
   05012 Parkinson disease
    100656057 (TUBB1)
   05014 Amyotrophic lateral sclerosis
    100656057 (TUBB1)
   05016 Huntington disease
    100656057 (TUBB1)
   05020 Prion disease
    100656057 (TUBB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100656057 (TUBB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656057 (TUBB1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100656057 (TUBB1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100656057 (TUBB1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100656057 (TUBB1)
  Exosomal proteins of colorectal cancer cells
   100656057 (TUBB1)
  Exosomal proteins of bladder cancer cells
   100656057 (TUBB1)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3 ART
Other DBs
NCBI-GeneID: 100656057
NCBI-ProteinID: XP_003420000
UniProt: G3SLF7
LinkDB
Position
Unknown
AA seq 451 aa
MREIVHIQVGQCGNQIGAKFWEVIGEEHGIDPVGSYHGDSALQLERISVYYNEAHGKKYV
PRAVLVDLEPGTMDSIRSSRLGALFQPDSFIHSNSGAGNNWAKGHYTEGAELIESVMDVV
RGQSERCDCLQGFQIVHSLGGGTGSGMGTLLLSKIREEFPDRILNSFSVMPSPKVSDTVV
EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL
RFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTARGSQQYRALSVAELTQQMFDARNIM
AACDPRRGRYLTVACIFRGKMSTKEVDDQLLAVQTRNSDCFVEWIPNNVKVAVCDIPPRG
LSMAATFLGNNTAIQELFRRVSEQFSAMFRRKAFVHWYTSEGMDVQEFGEAESNTHDLVS
EYQQFQDAKVALEEDGGVAEGEEAGPEDKGR
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgcgtgaaatcgtacacatccaggttggccagtgtggtaaccagatcggagccaagttc
tgggaggtgattggcgaggagcacggcatcgaccctgtaggcagttaccatggcgactcg
gccctgcagctggagaggatcagcgtgtactacaacgaggcccatggtaagaaatatgtg
cctcgagctgtcttggtggacctggagcctgggacgatggacagcatccgatctagcaga
ctcggagcccttttccagcctgatagttttatccacagtaactccggggcgggcaacaac
tgggccaagggccactacaccgagggggccgagctgatcgagagcgtgatggacgtggtg
aggggccagagcgagcgctgtgactgtctgcagggcttccaaattgtgcactccctaggc
gggggcacgggctcaggcatgggcacactgctcctgagcaagatcagggaggagttcccc
gaccgcatcctcaactccttcagtgtcatgccatcgcccaaagtctccgacaccgtggtg
gagccctacaacgccgtgctgtccatccaccagctcatcgagaatgccgacgcctgcttc
tgcatcgacaacgaggcgctctatgacatctgcttccgcaccctgaagctgaccacaccc
acctacggggacctcaaccacctggtgtccctgaccatgagcggcatcaccacatcgctg
cggttcccgggccagctcaacgccgacctgcgcaagctggcggtgaacatggtgcccttc
ccgcgcctgcacttcttcattcctggcttcgccccactcaccgcccgcggcagccagcag
taccgcgccctgtcggtggccgagctcacccagcagatgtttgatgcccgcaacatcatg
gcagcctgcgacccgcgccgaggccgctacctgacggtggcctgcatcttccggggaaag
atgtccaccaaggaggtggatgatcagctgctggccgtgcagaccaggaacagcgactgc
ttcgtggagtggatccccaacaacgtcaaggtggccgtctgcgacattccgccccggggg
ctcagcatggccgccacctttctaggcaacaacacggccatccaggagctgttccgcagg
gtttcggagcagttctcggccatgttcagaaggaaggcatttgtgcactggtacaccagt
gagggcatggacgtccaggagtttggagaggcggagagcaatacccatgacctggtgtcc
gagtaccaacagtttcaagacgccaaggtggctctggaggaagatggaggggttgcagag
ggggaggaggccgggccagaagacaagggacgttaa

KEGG   Loxodonta africana (African savanna elephant): 100666335
Entry
100666335         CDS       T04351                                 

Gene name
TUBB6
Definition
(RefSeq) tubulin beta-6 chain
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100666335 (TUBB6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100666335 (TUBB6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666335 (TUBB6)
   05012 Parkinson disease
    100666335 (TUBB6)
   05014 Amyotrophic lateral sclerosis
    100666335 (TUBB6)
   05016 Huntington disease
    100666335 (TUBB6)
   05020 Prion disease
    100666335 (TUBB6)
   05022 Pathways of neurodegeneration - multiple diseases
    100666335 (TUBB6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100666335 (TUBB6)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100666335 (TUBB6)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100666335 (TUBB6)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666335 (TUBB6)
  Exosomal proteins of colorectal cancer cells
   100666335 (TUBB6)
  Exosomal proteins of bladder cancer cells
   100666335 (TUBB6)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2
Other DBs
NCBI-GeneID: 100666335
NCBI-ProteinID: XP_003406436
UniProt: G3TH92
LinkDB
Position
Unknown
AA seq 445 aa
MREIVHIQARQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERISVYYNESSSQKYV
PRAILVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELMDSVLDVV
RKECEHCACLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQNKNSSYFVEWIPNNVKVAVCDIPPRG
LKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATVNDGEETSEDEEEMDE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggcgaggcagtgcggaaatcagatcggcactaagttt
tgggaagtgatcagcgatgaacacggcatcgacccggccggaggctatgtgggtgactcg
gcgctgcagctggagagaatcagcgtctactacaatgagtcatcctctcagaagtacgtg
cccagggccatccttgtggacttggagccgggaactatggacagtgtgaggtccggccct
ttcggtcagctcttccgaccagacaacttcatcttcggtcaaactggtgcaggaaacaac
tgggcaaaggggcactacacagaaggggccgagctgatggactcggtgctggacgtggtg
aggaaggagtgtgagcactgtgcctgcctgcaagggttccagctcacccactccctgggc
gggggaacagggtctggcatgggtactctgctcatcagcaagatccgagaggagtatccc
gataggatcatgaataccttcagcgtcatgccttcccccaaagtctctgacaccgtggtg
gagccctataacgccaccctgtccgttcaccagctggttgagaacacagatgaaacctac
tgcatcgataatgaggctttgtatgacatttgcttccgtaccctgaagctaaccaccccc
acctatggagacctgaaccacctagtgtctgccaccatgagcggggtcaccacctccctg
cgcttccccggccagctcaatgccgacctccgcaagctggccgtgaacatggtccctttc
ccccgcctccacttcttcatgcccggctttgcccctctgacggccaggggcagtcagcag
taccgggccctcacggtgccggaactgactcagcagatgttcgacgccaagaacatgatg
gcggcctgtgacccaagacacgggcgctacctcaccgtggccaccgtcttccggggcccc
atgtccatgaaggaggtggacgagcagatgctggccatccagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtcaaggtggccgtgtgcgacatcccgccccgcggc
ctcaagatggcttccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atttcggagcagttctcggccatgttccgacgcaaggccttcctgcactggttcacagga
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaatgacctggtgtca
gagtaccagcagtatcaagaagctacagttaatgacggagaagaaacttctgaggatgaa
gaagagatggatgaatag

KEGG   Loxodonta africana (African savanna elephant): 100666773
Entry
100666773         CDS       T04351                                 

Definition
(RefSeq) tubulin beta chain-like
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100666773
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100666773
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666773
   05012 Parkinson disease
    100666773
   05014 Amyotrophic lateral sclerosis
    100666773
   05016 Huntington disease
    100666773
   05020 Prion disease
    100666773
   05022 Pathways of neurodegeneration - multiple diseases
    100666773
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100666773
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100666773
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100666773
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100666773
  Exosomal proteins of colorectal cancer cells
   100666773
  Exosomal proteins of bladder cancer cells
   100666773
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100666773
NCBI-ProteinID: XP_010595881
LinkDB
Position
Unknown
AA seq 552 aa
MEGKPGTESRSPPGCRAPSRASVGPTEKHNPGPRVPVFSPSGANPGGTGDAGQLGLSLPS
SPQCILCSQGPAACSAEAPCMRSCTSRKASEAARLVARWALSNVGRSHYHVIPFPSFFQF
WEVISDEHGIHPTDSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGP
SGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLG
GGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLHFPGQLNADLRKLAVNMVPF
PRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGR
MSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKR
ISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAQEEEKGEGEG
GACVQYIVVSVF
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggaagggaaaccaggcacggagtccagatccccaccaggatgcagggccccttcgaga
gcaagtgtaggccccactgaaaaacacaaccctgggccccgggtcccggtcttcagcccc
tccggagctaacccaggtggaactggagatgcggggcagcttggtctctctctcccctcc
agtccacagtgcatcctttgctcccaagggccagcagcttgctccgcagaggcaccatgc
atgagatcatgcacatccagaaaggccagcgaggcagccagattggtggcaaggtgggcc
ctaagcaatgtcgggaggtcacactatcatgtcattccttttccttctttttttcagttt
tgggaggtcatcagtgatgagcatggtatccaccccactgacagttaccatggtgacagt
gacttgcagctggagagaatcaatgtctactacaatgaagctgctggtaacaaatacgta
cctcgggccatcctggtggatctggagcctggcaccatggactcagtcaggtctgggcca
tctggccagatcttcaggccagacaacttcgtctttggccagagtggtgccggcaataac
tgggcaaagggccactacacagagggagcagagctggtggactccgtgctggatgtggtg
aggaaggagtctgagagctgtgactgtctccagggcttccagctgacccactcgctgggg
ggtggcacggggtccgggatgggcacgctgctcatcagcaagatcagggaggagtacccc
gaccgcatcatgaacaccttcagcgttatgccttctcccaaggtgtcagacaccgtggtg
gaaccctacaatgccaccctctctgtccaccagctggtggagaacaccgatgaaacctac
tgcattgacaatgaggccctgtatgatatatgtttccgcaccctgaaactgaccaccccc
acatatggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
catttcccaggccagctgaatgcagacctccgcaaactggccgtgaatatggtgcccttc
ccccggctgcacttcttcatgcccggctttgcccccctgaccagccggggcagccagcag
taccgggccctgaccgttcctgagctcacccagcagatgttcgactccaagaacatgatg
gctgcctgcgacccccgccatggccgctacctgacggtggccgccatcttccggggtcgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccaccccgcggc
ctcaagatgtccgccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcaccgccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggcccaggaggaggagaagggggagggggaaggg
ggagcatgtgtccaatacatcgtggtctctgtattctaa

KEGG   Loxodonta africana (African savanna elephant): 100667055
Entry
100667055         CDS       T04351                                 

Definition
(RefSeq) tubulin beta chain-like
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100667055
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100667055
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100667055
   05012 Parkinson disease
    100667055
   05014 Amyotrophic lateral sclerosis
    100667055
   05016 Huntington disease
    100667055
   05020 Prion disease
    100667055
   05022 Pathways of neurodegeneration - multiple diseases
    100667055
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100667055
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100667055
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100667055
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100667055
  Exosomal proteins of colorectal cancer cells
   100667055
  Exosomal proteins of bladder cancer cells
   100667055
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100667055
NCBI-ProteinID: XP_003417878
LinkDB
Position
Unknown
AA seq 498 aa
MGTPASCHEQLFSRETPNFHFSDPGKPKPCRLCPGQAALKAPEDLVVATEWKVFYCEVRL
CGWLNAAFFLSQFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVD
LEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESC
DCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATL
SVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLN
ADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRH
GRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATF
IGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD
ATADEQGEFEEEEGEDEA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggggaccccagcctcctgccacgagcagctgttctcccgggaaacgcccaatttccat
ttttctgaccctggaaaacccaagccctgcaggctgtgccccggtcaggcggccctaaaa
gctcccgaagatttggttgtcgcaactgagtggaaggttttttattgtgaggtgcgtctc
tgcggttggctaaatgcagccttcttcttgtcgcagttttgggaggtcatcagtgatgag
catggtatcgaccccactggcagttaccatggcgacagtgacttgcagctggagagaatc
aatgtctactacaatgaagccactggtaacaaatatgtacctcgggccatcctggtggat
ctggagcctggcaccatggactcagtcaggtctgggccatttggccagatcttcaggccg
gacaacttcgtgttcggccagagtggtgccggcaataactgggcaaagggccactacaca
gagggagcagagctggtggactccgtgctggatgtggtgaggaaggagtctgagagctgt
gactgtctccagggcttccagctgacccactcgctggggggtggcacggggtccgggatg
ggcacgctgctcatcagcaagatcagggaggagtaccccgaccgcatcatgaacaccttc
agcgttatgccttctcccaaggtgtcagacaccgtggtggaaccctacaatgccaccctc
tctgtccaccagctggtggagaacaccgatgaaacctactgcattgacaatgaggccctg
tatgatatatgtttccgcaccctgaaactgaccacccccacatatggggacctcaaccac
ctggtgtcggccaccatgagcggggtcaccacctgcctgcgtttcccaggccagctgaat
gcagacctccgcaaactggccgtgaatatggtgcccttcccccggctgcacttcttcatg
cccggctttgcccccctgaccagccggggcagccagcagtaccgggccctgaccgttcct
gagctcacccagcagatgttcgactccaagaacatgatggctgcctgcgacccccgccat
ggccgctacctgacggtggccgccatcttccggggccgcatgtccatgaaggaggtggac
gagcagatgctcaacgtgcagaacaagaacagcagctacttcgtggagtggatccccaac
aacgtgaagacggccgtgtgcgacatcccaccccgcggcctcaagatgtccgccaccttc
atcggcaacagcacggccatccaggagctgttcaagcgcatctccgagcagttcaccgcc
atgttccggcgcaaggccttcctgcactggtacacgggcgagggcatggatgagatggag
ttcaccgaggccgagagcaacatgaacgacctggtgtccgagtaccagcagtaccaggac
gccacggccgacgagcaaggggagttcgaggaggaggagggcgaggatgaggcttaa

KEGG   Loxodonta africana (African savanna elephant): 100670393
Entry
100670393         CDS       T04351                                 

Gene name
TUBB
Definition
(RefSeq) LOW QUALITY PROTEIN: tubulin beta chain
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100670393 (TUBB)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100670393 (TUBB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100670393 (TUBB)
   05012 Parkinson disease
    100670393 (TUBB)
   05014 Amyotrophic lateral sclerosis
    100670393 (TUBB)
   05016 Huntington disease
    100670393 (TUBB)
   05020 Prion disease
    100670393 (TUBB)
   05022 Pathways of neurodegeneration - multiple diseases
    100670393 (TUBB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670393 (TUBB)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100670393 (TUBB)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100670393 (TUBB)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100670393 (TUBB)
  Exosomal proteins of colorectal cancer cells
   100670393 (TUBB)
  Exosomal proteins of bladder cancer cells
   100670393 (TUBB)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100670393
NCBI-ProteinID: XP_023397432
LinkDB
Position
Unknown
AA seq 371 aa
MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG
FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQL
VENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLASLAAHADLRSW
QXHMFPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTV
AAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTA
IQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEE
EDFGEEAEEEA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggactctgttcgctcaggtccttttggtcagatcttcagaccagacaactttgttttt
ggtcagtctggggcaggcaacaactgggccaaaggccactatacagagggggccgagctg
gtcgactctgtcttggatgtggtgcggaaggaggctgagagttgtgactgcctgcagggc
tttcaactgacccactcacttggcggaggcacaggctctgggatgggcaccttgctcatc
agtaagatccgtgaagagtatcctgaccgcatcatgaataccttcagtgtggtgccctca
cccaaagtatccgacactgtggttgagccctacaatgccaccctctctgtccaccagttg
gtagagaacactgacgagacctattgcattgataatgaggccctttacgatatctgcttc
cgcactctcaagctgaccacgccaacctatggagacctgaaccatcttgtctcagccacc
atgagcggtgtcaccacctgcctcgcttccctggcagctcatgctgacctccgcagctgg
cagnntcacatgttccctttcccacgtctccacttcttcatgcctggctttgccccacta
accagccgtggcagccagcagtaccgggccctcactgtgcctgagctcacccagcaggtc
ttcgatgccaagaacatgatggctgcctgtgacccccgccatggccggtacctcactgtg
gctgctgtcttccgtgggcggatgtccatgaaggaggtggatgagcagatgctcaacgta
cagaataagaatagcagctattttgtggaatggatccccaacaacgtcaagacggctgtc
tgtgacatcccgccccgtggcctcaagatggcggtcaccttcattggtaacagcacggcc
atccaggagctcttcaagcgcatctcagagcagttcactgccatgttccgtcggaaggcc
ttcctccactggtacacaggtgagggtatggacgagatggaattcactgaggctgagagc
aacatgaatgacctcgtctctgagtaccagcagtaccaggatgccactgcagaagaggaa
gaggatttcggtgaggaggctgaagaggaggcctaa

KEGG   Loxodonta africana (African savanna elephant): 100671690
Entry
100671690         CDS       T04351                                 

Definition
(RefSeq) uncharacterized protein LOC100671690
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100671690
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100671690
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100671690
   05012 Parkinson disease
    100671690
   05014 Amyotrophic lateral sclerosis
    100671690
   05016 Huntington disease
    100671690
   05020 Prion disease
    100671690
   05022 Pathways of neurodegeneration - multiple diseases
    100671690
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100671690
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     100671690
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    100671690
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100671690
  Exosomal proteins of colorectal cancer cells
   100671690
  Exosomal proteins of bladder cancer cells
   100671690
SSDB
Motif
Pfam: Tubulin Tubulin_C 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srsx Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 100671690
NCBI-ProteinID: XP_023413750
LinkDB
Position
Unknown
AA seq 955 aa
MPMQGAQGRLRGSLNATPPTTPHSGLAGNQTGPWCLEVSIPDELFLSLGLVSLVENMLVV
AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGVLAAWAGVVQQLDNAI
DVFICGSMVSSLCFLGAIAVDRYITIFYALRYHSIVTLPRARWAIATIWAASVVCSTLFI
AYYDCTAVLLCLVSFFLALVVLMAVLYMHMLARACLHARSIARLHKRWRPVHQGLGLKGA
ATLSILLGSFFLCWGPFFLHLTLIVLCPQHPTCSCVFKNFKLFLTLIICNSIVDPLIYAF
RSQELRKTLKEVLLCSWKSGKKPSRGAHRWHQEDCDQQSHVPRSGHLVEKSLGERRRVSF
AEQTVTRAPGYPQPSIPASRLACFSEDLGPVPSRRDPENSEYLVSSAVTRTGAVTGSEGQ
ETSIVFPGAHSPRGQLVGEPPLPPGTQPKSQGPGPVRPSYSGRPRRCRARRIVRGDRRMR
GADAAEPMPQSAEPGRCSSAAASAEMREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGN
YVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQS
GAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKV
REEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTL
KLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTA
RGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQS
KNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFL
HWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgcccatgcagggagcccaagggaggctgcgaggctccctcaatgccacaccccccaca
acaccccactcgggactggctggcaaccagacaggcccctggtgcttggaggtatccatc
ccggatgagctcttcctctcactggggctggtgagcctggtggagaatatgctggtggtg
gctgccattgccaagaaccgcaacctgcactcgcccatgtactacttcatctgctgcctg
gccgtgtccgacctgctggtgagtgtgagcaacgtgctggagacagctgtcatgctgctg
ctggaggcaggcgtgctggctgcatgggcaggtgtagtgcagcagctggacaatgccatc
gacgtgttcatctgcggctccatggtgtccagcctctgcttcctgggcgccattgcagtg
gaccgctacatcaccatcttctatgcgcttcgctaccacagcattgtgacactgccccgg
gcacgctgggccattgccaccatctgggcggccagtgtggtctgcagcaccctcttcatt
gcctactatgactgcacagccgtgctgctctgccttgtcagcttcttcctggccctggtg
gtgctcatggcggtgctgtatatgcacatgctggcccgggcctgcctccacgcccgcagc
atcgcccggctgcacaagcgttggcgcccagtccaccagggcctcggcctcaagggtgcc
gccacactctccatcctgctgggctccttctttctctgctggggccccttcttcctgcac
ctcacactcatcgtcctctgcccccagcatcccacctgcagctgcgtcttcaagaacttc
aaactctttctcaccctcatcatctgcaactccatcgtggaccctctcatctatgccttt
cgtagccaggagctccgcaagacactcaaagaggtgctgctgtgctcctggaagagtggc
aagaagccctcaaggggtgcccaccgctggcatcaggaggactgtgaccagcagagccat
gtgccacgaagtggccacctcgtggagaagtcccttggggagcggaggcgggtatccttc
gccgaacagacagtgacccgtgcccctgggtacccacagccgtccatccccgcctcgcgg
cttgcttgcttctcagaggatttaggaccagtcccctcccgaagggatccggaaaactcc
gagtaccttgtctcctcagccgtgacacggacaggggctgtgacggggtccgagggccag
gagacttctattgtcttccctggagcccacagcccccgtggccagctggtcggggagccg
cccctccctccgggcactcagcccaaatcccaagggccgggcccggtccggcccagctac
tcggggcggccgaggaggtgccgcgcccgccgcattgtgcgcggagaccggcggatgcgc
ggtgctgatgctgcggagccgatgccgcagtccgcggagccgggtcggtgcagttctgca
gccgccagcgccgagatgagggagatcgtgcacatccaggccggccagtgcggcaaccag
attggggccaagttctgggaagtcatcagcgatgagcacggcatcgatcccagtggcaac
tatgtgggggactcagacctgcagctggaacggatcagcgtctactacaatgaggcctcc
tctcacaaatacgtgcctcgggccattctggtggacctggagcctggcaccatggacagc
gtccgttctggagcctttgggcacctcttcaggcccgacaacttcatctttggtcagagt
ggagctggcaacaactgggccaaaggtcactacacagagggtgcagagctggtggactca
gtcctggatgtcgtgcggaaggagtgtgagaactgcgactgcctgcagggcttccagctg
acccactcactgggtgggggcactgggtcgggcatgggcacgctgctcattagcaaggtt
cgagaggaataccctgatcgcatcatgaacaccttcagcgtggtgccctcacccaaggtg
tctgacaccgtagtggagccctacaacgccacgctatccatccaccagctggtggaaaac
accgacgagacctactgcatcgacaatgaagccctctacgacatctgcttccgcaccctc
aagctggccacgcccacctatggcgacctcaaccacctcgtgtcagccaccatgagcggc
gtcaccacctccctccgcttccccgggcagctcaatgcagacctgcgaaagctggccgtc
aacatggtgcccttcccccgcctgcacttcttcatgcctggctttgccccactcacagcc
cggggcagccagcagtacagggccctgacagtgcccgagctcactcagcagatgttcgat
gcgaaaaacatgatggcagcctgtgacccgcgccatggccgctacctcactgtggccacg
gtcttccgtgggcgcatgtccatgaaggaggtggacgagcagatgctggccatccagagc
aagaacagcagctactttgtagagtggatccccaacaacgtcaaggtggctgtatgcgac
attccgccccgtggcctcaagatgtcctccaccttcatcggcaacagcacggccatccag
gagctattcaagcgcatctcagagcagtttactgccatgtttcggcgcaaggccttcctg
cactggtacacaggcgagggcatggatgagatggagttcactgaagccgagagcaacatg
aacgacctggtgtctgagtaccagcagtaccaggatgccacggctgaggaggagggcgag
atgtatgaggatgatgaggaggagtcggaggcccagggtcccaagtga

KEGG   Loxodonta africana (African savanna elephant): 104847353
Entry
104847353         CDS       T04351                                 

Gene name
TUBB4B
Definition
(RefSeq) tubulin beta-4B chain
  KO
K07375  tubulin beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04540  Gap junction
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104847353 (TUBB4B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104847353 (TUBB4B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104847353 (TUBB4B)
   05012 Parkinson disease
    104847353 (TUBB4B)
   05014 Amyotrophic lateral sclerosis
    104847353 (TUBB4B)
   05016 Huntington disease
    104847353 (TUBB4B)
   05020 Prion disease
    104847353 (TUBB4B)
   05022 Pathways of neurodegeneration - multiple diseases
    104847353 (TUBB4B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104847353 (TUBB4B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     104847353 (TUBB4B)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    104847353 (TUBB4B)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104847353 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   104847353 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   104847353 (TUBB4B)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 104847353
NCBI-ProteinID: XP_010600937
LinkDB
Position
Unknown
AA seq 373 aa
MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG
FQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQL
VENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLT
VAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNST
AIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEE
EGEFEEEAEEEVA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggactctgtacgctcagggcccttcgggcagatcttccgccccgacaacttcgtcttt
ggtcagagtggtgctgggaacaactgggccaaagggcactacacagaaggtgcagagctg
gtcgactcggtgctggacgttgtgaggaaggaggccgagagctgtgactgcctgcagggt
ttccagctgacccactccctgggtggggggactgggtctgggatgggcaccctcctcatc
agcaagatccgggaggaataccctgacaggattatgaacaccttcagtgtggtgccctcg
cccaaggtgtcagacacggtggtggagccctacaacgccaccctctcggtgcaccagctg
gtggagaatacagacgagacctattgcattgataacgaagctctctacgacatctgcttc
agaaccctaaagctgaccacgcccacctacggtgatctgaaccacctggtgtcagctacc
atgagtggggtcaccacctgcctgcgcttcccaggccagctcaatgctgacctgcggaag
ctggccgtcaacatggtgcccttcccccgcctacacttcttcatgcccggctttgcccca
ctgaccagccggggcagccagcagtaccgggccctgaccgtgcccgagctcacccagcag
atgtttgatgccaaaaacatgatggccgcctgtgacccccgccacggccgctacctaacg
gtggccgccgtcttccggggccgcatgtccatgaaggaggtggacgagcagatgctgaac
gtgcaaaacaagaacagcagctacttcgtggagtggatccccaacaacgtgaagacggct
gtctgcgacatcccgccccgcggcctcaagatgtctgccaccttcattggtaacagcacg
gccatccaggagctgttcaagcgcatctccgagcagttcacggccatgttccggcgcaag
gccttcctgcactggtacacaggcgagggcatggacgagatggagttcactgaggctgag
agcaacatgaacgacctggtgtccgagtaccagcagtaccaggatgccacggccgaggag
gagggcgagtttgaggaggaggccgaggaggaagtggcctag

DBGET integrated database retrieval system