KEGG   Loxodonta africana (African savanna elephant): 100653733
Entry
100653733         CDS       T04351                                 

Gene name
RIMS2
Definition
(RefSeq) LOW QUALITY PROTEIN: regulating synaptic membrane exocytosis protein 2
  KO
K15297  regulating synaptic membrane exocytosis protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100653733 (RIMS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100653733 (RIMS2)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100653733 (RIMS2)
  Small GTPases and associated proteins
   Rab associated proteins
    100653733 (RIMS2)
SSDB
Motif
Pfam: C2 FYVE_2 PDZ_6 PDZ FYVE
Other DBs
NCBI-GeneID: 100653733
NCBI-ProteinID: XP_023401702
LinkDB
Position
Unknown
AA seq 1608 aa
MSAPAGLRGRPAPTPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKV
KEEHKPQPTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQ
QQQEQKGDAPTCGICHKTKFADGCGHHCSYCQTRFCARCGGRVSLRSNKEDKVVMWVCNL
CRKQQEILTKSGAWFYNSGTNTPQQPDQKVLRGLRNEEAPQEKKAKLHEQAQFQGPSGDL
AVPAVEKSRSHGLTRQNSIKNGSGMKHQIGSDIASDRKRSPSVSRDQNRRYDQREEREEY
SQQYAPSDSAMPRSPSDYADRQSQHESQFYEESDDVSYRDSNRRSHRRSKEYIVDEEEDV
ESRDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLA
NAELEDSRISTLRMERPSRQRSISERRAAMENQRSYSMERTREAQEPGSYPQRTTNRSPP
TPRRSPIPIDRPDMRRTDSLRKQHHLDPSFAVRKTKREKMETMLRNDSLSSDQSESVRPP
PPKPHKKGGKLRQVSLSSSGAEEELASTPEYTSCDDVEIESESVSEKGDSQKGKRKTSEQ
AVLSDSYTRSERQKKMMYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPV
TWQPSKDGDCLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGS
LADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDS
THAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSIKLWFDKVGHQLIVT
ILGAKDLLSREDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPKWNQTFIYSPVHRRE
FRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQTHDVSSLPLPHPSP
YMPRRQLHGESPTRRLQRSKRISDSEVSDYDCDDGIGVVSDYRHNGRDLQSSTLSVPEQV
MSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVEQGLRGTRSSTGHYNTISRMDRHR
VMDDHYSPDRDRDCEAADRQPYHRSRPTEQRPLLERTTTRSRSTDRPDTNLMRSMPSLMT
GRSAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERKEVDSPRRYSGA
MDIEERNRQMKINKYKQVAGSDPRLEQDYHLKHRSGWDPHRGADNISTKSSDSDVSDISA
VSRTSSASRFSSASYMSVQSERPRGNKKISVFTSKMQSRQMGISGKNMTKSTSISGDMCS
LEKNDGSQSDTAVGALGSGGKKRRSSIGAKMVAIVGLSRKSRSASQLSQTEAGGKRLRST
VQRSTETGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLG
PAQLVGRQTLATPAMGKNFYHMIPKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDN
GVCIAKKKTKVARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLD
ELELSNMVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgtcggctcctgccgggctccggggccgcccggctcctaccccggcggcctctcagccg
cctctgcagccggagatgcccgacctcagccacctcacggaggaggagaggaaaatcatc
ctggccgtcatggatcggcagaagaaagaagaggagaaggagcagtccgtgctcaaggtc
aaagaagagcacaaaccacaaccgacacagtggtttccctttagtgggatcactgaactg
gtaaataacgttcttcagccccagcaaaaacaacaaaatgaaaaggagccccagacaaaa
ctgcatcagcagttcgaaatgtataaggagcaggtaaagaagatgggagaagaatcacag
cagcagcaagagcagaagggtgacgccccgacctgtggcatctgccacaaaacaaagttt
gccgatggctgtggccatcactgctcgtactgccagacgaggttctgtgctcgttgtgga
ggccgggtgtcactacgctcaaacaaggaggacaaagtggttatgtgggtatgtaatttg
tgccgaaaacaacaagaaatcctcactaaatcaggagcgtggttttataatagtggaact
aatacaccacagcagcctgatcaaaaggttctcagaggtctgcgaaatgaagaggcacct
caggagaaaaaagcaaaactgcatgagcaggcccagttccaaggaccctcaggtgactta
gctgtacctgcagtggagaaaagtcgatctcacgggctcacaagacagaattctatcaag
aatgggtcaggaatgaagcaccaaattggcagtgacatagcttcagacaggaaaagaagt
ccatcagtgtccagagatcagaatagaagatacgaccaaagggaagaaagagaggaatat
tcacaacagtatgcgccttcagatagcgcaatgcctagatctccatcagattatgctgat
aggcagtctcaacatgaatctcagttttatgaagaatctgatgatgtgagttatagggac
tccaacaggagaagtcataggcgttccaaagagtatattgtagatgaggaggaggatgtg
gagagcagagatgaatatgaaagacaaagaagagaggaggagtaccaggcacgctaccga
agcgatccaaatttggcccgttatccagtaaagccccagccctatgaagaacaaatgcgt
atccatgccgaagtgtcccgagctcggcatgagagaagacatagtgatgtttctctggca
aatgctgaactggaagattccaggatttctacgctaaggatggaacgaccatcaaggcaa
agatctatatctgaacggagagccgccatggaaaatcagcgatcttactcaatggaaaga
actcgagaggctcaggaaccaggttcttatccacaaaggaccacaaaccgtagtcctcct
acccctcggaggagtccaatacccattgatagaccagacatgaggcgtactgactcatta
aggaaacaacaccacttagatcccagctttgctgtaaggaaaacgaaacgggaaaaaatg
gaaacgatgttaaggaatgactctctcagttcagaccagtcagagtcagtaagaccccca
ccaccaaagcctcataaaaaaggaggtaaactgcgccaagtttcattgagcagttcagga
gcagaggaggaactagcttccacgcctgaatatacaagctgtgatgatgttgagattgaa
agtgagagtgtaagtgaaaaaggggacagtcaaaagggaaaaagaaaaactagtgagcag
gcagttttgtcggactcttacaccaggtctgagagacaaaagaaaatgatgtactttggt
ggccactctttggaagaggatttggaatggtctgagcctcagattaaggactctggggta
gatacgtgtagtagcacaactcttaacgaggagcatagccatagtgataagcatcctgtg
acctggcagccatctaaagatggagattgtttaattggccgcattttattaaataaacgt
ctaaaagatggaagtgtacctcgagactcaggagcaatgcttggcttaaaggttgtagga
ggaaagatgactgaatcaggtcggctttgtgcatttattaccaaagtaaaaaaaggaagt
ttagctgatactgtaggtcatcttagaccaggtgatgaagtgttagaatggaacggaagg
ctgttgcaaggagccacatttgaagaagtatacaacatcattctggaatccaaacctgaa
ccacaagtggagcttgttgtttcaagacctattggagatatacctagaatacctgacagc
acacatgcacaactggaatctagttctagctcatttgaatctcaaaaaatggaccgtcct
tctatttccgttacctctcccatgagtcctggcatgttgagggatgttccacagttctta
tctggacaactttcaataaaactgtggtttgacaaggttggtcaccaattaatagttaca
attttgggagcaaaggatctcctttccagggaagatgggaggccaaggaatccttacgtt
aaaatttactttcttccagacagaagtgataaaaacaagagaagaactaaaacagtaaag
aaaacattggaacccaaatggaaccaaacattcatttattctccagtccaccgaagagaa
tttcgagaacgaatgcttgagattaccctttgggatcaagctcgagttcgagaggaagaa
agtgaatttttaggagagattttaattgaattagaaacagcattattagatgatgagcca
cattggtacaaacttcagacccatgatgtctcttcattgccacttccccacccttctcct
tacatgccacgaagacaacttcatggagagagcccaacacgaaggttgcaaaggtcaaaa
agaataagtgatagtgaagtctctgactatgactgtgatgatggaattggtgtggtatca
gattatcgacacaatggtcgagatcttcagagctcaacattatcagtgccagaacaagta
atgtcatcaaaccattgttcaccatcagggtctccccaccgagtagatgtaataggaagg
actagatcatggtcacccagtgtccctcctccacaaagtcggaatgtggaacagggactt
cgagggacacgctcttctactggacattataatacaattagccgaatggatagacatcgt
gtcatggatgaccattattctccagacagagacagggattgtgaagcagcagatagacag
ccatatcacagatccagaccaacagaacaacggcctctcctagagcggaccaccacccgc
tccagatccactgaccgtcctgatacaaacctcatgaggtcgatgccgtcattaatgacc
ggaagatctgcccctccttcacctgccttatcgaggtctcatcctcgtactgggtctgtc
caaacaagcccatcaagtactccagtggcaggacgaaggggccgacagcttccacagctt
ccaccaaagggaacgttggagagaaaagaagtggactccccaagaagatattcaggtgct
atggatatagaggagagaaatcgccaaatgaaaattaacaaatacaaacaggtagccgga
tcagatcccagactggaacaagattaccatttgaagcatcgatcaggatgggatcctcat
agaggggcagataatatttccactaaatcttcggacagtgatgtaagtgatatatctgcg
gtttcaagaactagtagtgcttctcgtttcagcagcgcaagctacatgtctgtccaatca
gaacgaccaagaggaaacaagaaaatcagtgtctttacatccaaaatgcaaagcagacaa
atgggcatctcagggaagaacatgactaaaagcaccagcatcagtggagacatgtgctca
ctagagaagaatgacggcagccagtcggacactgcagtgggcgccttgggcagcggcggc
aaaaagcggcgctctagcattggggccaaaatggtagctattgttggtctctcacggaaa
agtcgcagcgcttctcagctcagccaaacggaagcaggaggtaaaaggctacggagcact
gtccagagaagtacagagacaggtctggcagtggaaatgaggaactggatgactcgacag
gcgagccgagagtctaccgatggcagcatgaacagctatagttcagaaggaaatctgatt
ttccctggcgtccgcttggcctctgatagccaattcagtgattttttggatggccttggc
cctgcccagctagtggggcgccagactctggctacacctgcaatgggtaagaatttctat
cacatgatcccaaaaaaaggacagctggaggtggaaatcattcgggcccgcggccttgtt
gtcaaaccaggttctaagacactgccagcaccatatgtaaaggtgtatctactggataat
ggagtctgcatagccaaaaagaaaacaaaagtagcaaggaaaacgctggaacccctttac
cagcagctattatcatttgaagaaagccctcaaggaaaggttttacagatcattgtctgg
ggagattatggccgcatggatcacaagtcctttatgggagtggcccagatacttttagat
gaactggagctatccaatatggtgattggatggttcaaactttttcccccttcttcccta
gtagatccaaccttggcgcctctgacaagaagagcttcccaatcgtctctggaaagctca
accggaccttcttattctcgttcatag

DBGET integrated database retrieval system