KEGG   Loxodonta africana (African savanna elephant): 100653765
Entry
100653765         CDS       T04351                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04659  Th17 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05216  Thyroid cancer
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100653765 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100653765 (RXRG)
   03320 PPAR signaling pathway
    100653765 (RXRG)
   04919 Thyroid hormone signaling pathway
    100653765 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100653765 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653765 (RXRG)
   05202 Transcriptional misregulation in cancer
    100653765 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    100653765 (RXRG)
   05216 Thyroid cancer
    100653765 (RXRG)
   05222 Small cell lung cancer
    100653765 (RXRG)
   05223 Non-small cell lung cancer
    100653765 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100653765 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100653765 (RXRG)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100653765 (RXRG)
Nuclear receptors [BR:lav03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100653765 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 100653765
NCBI-ProteinID: XP_010593230
UniProt: G3T140
LinkDB
Position
Unknown
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSAVLSTGKSMDNHLSYTDTPVSAPRTLSAVG
APLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNNVSSSEDIKPLPGLPG
IGNMNYLSTSPGPLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAESASNGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccaccggctttggtggctcccctggc
cacaccggctccacgtccatgagtccatcggcagtcttgtccacagggaagtcaatggac
aaccacctcagctacaccgacacccctgtgagtgccccacggactctgagtgcagtgggg
gcccccctcaatgctctgggttctccctaccgagtcatcacttctgccatgggccccccc
tcaggagcattggcagcccctccaggaatcaatttggttgccccacccagctctcagcta
aatgtggtgaacaacgtcagcagttcggaggacatcaagcccttaccaggccttccaggg
attggaaacatgaactacctgtccaccagccctgggcctctggttaaacacatttgtgcc
atctgtggggacagatcctcaggaaagcactacggggtgtacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatctacacctgtcgggataataaagat
tgcctcattgacaagcgccagcgaaatcgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagagaggcagaggagccgggagcgggcc
gagagtgaggcagaatcagccagcaatggccatgaagacatgcctgtggagaggattcta
gaagctgaacttgctgttgaaccaaagacggaatcctatggtgacatgaatatggagaac
tcaacgaatgaccctgtcacgaacatatgccatgctgctgataagcagcttttcaccctc
gttgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgagcagggtggaatgagttgttgatcgcctccttctcccaccgctcggtttcc
gtgcaggatggcatccttctagccacgggtttacacgtccaccggagcagtgctcacagt
gctggggtcggctccatctttgacagagttctgacggagctcgtttccaaaatgaaagat
atgcagatggacaaatcggagctgggctgcctgcgagccattgtgctgtttaacccagat
gcaaaggggctgtccaacccatctgaggtagaggctctgcgagagaaggtttacgccacc
ctcgaggcctacaccaagcagaagtatccggaacagccaggcaggtttgcaaagctgctg
cttcgcctcccagccctgcgctccattggcttgaaatgcctggagcatctcttcttcttc
aagctcataggggacacacccattgacaccttcctcatggagatgttggaaaccccactg
cagatcacctga

KEGG   Loxodonta africana (African savanna elephant): 100662699
Entry
100662699         CDS       T04351                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X2
  KO
K08525  retinoid X receptor beta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04659  Th17 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05216  Thyroid cancer
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100662699 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100662699 (RXRB)
   03320 PPAR signaling pathway
    100662699 (RXRB)
   04919 Thyroid hormone signaling pathway
    100662699 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100662699 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662699 (RXRB)
   05202 Transcriptional misregulation in cancer
    100662699 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100662699 (RXRB)
   05216 Thyroid cancer
    100662699 (RXRB)
   05222 Small cell lung cancer
    100662699 (RXRB)
   05223 Non-small cell lung cancer
    100662699 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100662699 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100662699 (RXRB)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100662699 (RXRB)
Nuclear receptors [BR:lav03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100662699 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100662699
NCBI-ProteinID: XP_003421092
LinkDB
Position
Unknown
AA seq 532 aa
MSWTARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPHGAPPPSPPGPPLPPSAAPSLGGTGAPPQ
PPLPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
ERILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcttggactgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagagatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcggcagcgggagaacaacaaaccccg
gagccggaaccgggggaggctggacgggacgggatgggcgacagcgggcgggactctcga
agcccagacagctcctccccaaatccccttccccacggagcccctcctccttctcctcct
gggccacccctgcccccttcagcagccccatcccttggaggcactggggctccaccccaa
cccccgctgccaccacctccactgggatcccccttcccagtcatcagctcttccatgggg
tctcccggtctgccccctccagctcccccaggattctccgggcctgtgagcagcccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggc
aaacgtctgtgtgcaatctgcggggacagaagctcaggcaaacactatggggtgtacagc
tgtgagggttgcaagggcttcttcaagcgcaccatccgtaaggacctgacctactcgtgc
cgggacaacaaggactgcacagtggacaagcgccagcggaaccgctgtcagtactgccgc
tatcagaagtgcctggccacaggcatgaagagggaggcggtacaggaggagcgtcagcgg
gggaaggacaaggatggggacggagagggggctgggggagcccccgaggagatgcctgtg
gagaggatcctggaggcagagcttgctgtggaacagaagagtgaccagggcgttgagggt
cctgggggaactgggggtagtggcagcagtccaaatgaccctgtgacaaacatctgtcag
gcagctgacaaacagctcttcacacttgttgagtgggcgaagaggattccacacttttcc
tccttgcctctggatgaccaggtcattttgctacgggcagggtggaacgagctcctcatt
gcctccttctcccatcgatccattgatgtccgagatggcatcctccttgccacaggtctt
catgtgcaccgcaattcagcccattctgcaggcgtgggagccatctttgatcgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctg
agggcaatcattctcttcaatccagatgccaagggcctctccaaccccagcgaggtggag
gtcctgcgggagaaagtatatgcgtcactggagacctactgcaaacagaagtaccctgag
cagcagggacggtttgccaagctgctgctacgtcttcctgccctccggtccattggcctc
aagtgtctagagcatctgtttttcttcaagctcattggtgacacccccattgataccttc
ctcatggagatgcttgaggctccccaccagctggcctga

KEGG   Loxodonta africana (African savanna elephant): 100674208
Entry
100674208         CDS       T04351                                 

Definition
(RefSeq) retinoic acid receptor RXR-alpha-like
  KO
K08524  retinoid X receptor alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03320  PPAR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04659  Th17 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04932  Non-alcoholic fatty liver disease
lav04976  Bile secretion
lav05160  Hepatitis C
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05216  Thyroid cancer
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674208
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100674208
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100674208
   03320 PPAR signaling pathway
    100674208
   04919 Thyroid hormone signaling pathway
    100674208
   04928 Parathyroid hormone synthesis, secretion and action
    100674208
  09154 Digestive system
   04976 Bile secretion
    100674208
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674208
   05202 Transcriptional misregulation in cancer
    100674208
  09162 Cancer: specific types
   05226 Gastric cancer
    100674208
   05216 Thyroid cancer
    100674208
   05222 Small cell lung cancer
    100674208
   05223 Non-small cell lung cancer
    100674208
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100674208
  09172 Infectious disease: viral
   05160 Hepatitis C
    100674208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100674208
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100674208
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100674208
Nuclear receptors [BR:lav03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100674208
SSDB
Motif
Pfam: zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100674208
NCBI-ProteinID: XP_023397914
LinkDB
Position
Unknown
AA seq 304 aa
MAAPSLHPPLGPGVGSSLGSPGQLHSPISTLNSPINGMGPPFSVISSPMGPHSMSVPTAP
ALGFGSGSPQQRNESLARVWEEPGQTTAVKSPSHLMSLPWPACPRACLATPHMCGHPLSS
PMNLVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCK
GFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREGRAGRGQGGRPGG
YALQGIPPPRAMCRGLYTPGRPPEPCAGGLYPPGHPQGHVQGGCALQGVPRATGRGRYAL
EDGP
NT seq 915 nt   +upstreamnt  +downstreamnt
atggccgcgccctcgctgcacccacccctggggcccggcgttggctcctcactcggctcc
ccgggccagctacactcgcccatcagcactctgaattcccccatcaatggcatgggccca
cccttctcggttattagctcacccatgggcccgcactccatgtcggtgcccactgcacct
gccctgggctttggctcgggcagcccccagcagagaaatgaaagcctggcgagggtctgg
gaagagccaggccagaccacggctgtcaagagtccgagccatctgatgtctctcccctgg
cctgcgtgtcccagagcctgcctggcaactccccacatgtgtggccaccctctcagctca
cccatgaacctcgtcagcagcactgaggacatcaagcccccgctgggcctcaatggcgtc
ctcaaggttcccgcccacccctcaggaaacatggcgtccttcaccaagcacatctgtgcc
atctgtggggaccgctcctcaggcaaacactacggggtgtacagctgcgagggctgcaag
ggcttcttcaagcggacggtacgcaaggacctcacgtacacctgccgcgacaacaaggac
tgcctgatcgacaagcggcagcggaaccggtgccagtactgccgctaccagaagtgcctg
gccatgggcatgaagcgggaaggtagggcgggcagggggcagggcgggcgccccgggggc
tatgccctccagggcattcctcccccccgggccatgtgcagggggctgtacactccaggt
cgccccccagagccatgtgcagggggactgtaccctccagggcacccccagggccatgtg
cagggaggctgtgccctccagggtgtccccagggccacagggagggggcgctatgccctc
gaggatggcccctag

DBGET integrated database retrieval system