KEGG   Loxodonta africana (African savanna elephant): 100653783
Entry
100653783         CDS       T04351                                 

Gene name
ADORA2A
Definition
(RefSeq) adenosine receptor A2a
  KO
K04266  adenosine receptor A2a
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
lav05012  Parkinson disease
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100653783 (ADORA2A)
   04020 Calcium signaling pathway
    100653783 (ADORA2A)
   04024 cAMP signaling pathway
    100653783 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100653783 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100653783 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100653783 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    100653783 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100653783 (ADORA2A)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    100653783 (ADORA2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100653783
NCBI-ProteinID: XP_010597015
UniProt: G3T8T2
LinkDB
Position
Unknown
AA seq 400 aa
MGISVYIMVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVVVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKG
IIAVCWVLSFAIGLTPMLGWNNCGWPKEDRNHSQACGAGQVACLFEYVVPMNYMVYYNFF
ACVLVPLLLMLGVYLRIFLAARRQLKQMESQPAPGERARSTLQKEVHAAKSLAIIVGLFA
LCWLPLHVINCFTFFCPECAHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKII
RSHVLRRREPFKAGGTSARALAAYGSGDGEQVSLRLNSHPLGIWANGSAPSPEPRPNGYS
LGLVSRGGALEFHGDKGLPDVSPESAGLVAPLAQDGAGVS
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgggcatctcagtgtacatcatggtggagctagccattgcggtgctggccatcttgggc
aatgtgctggtttgctgggctgtgtggctcaacagcaacctgcagaatgtcaccaactac
ttcgtggtgtcgctggcagcggccgacattgccgtgggggtgctggctatcccctttgcc
atcaccatcagcacagggttctgtgccgcctgccacggctgcctcttcttcgcctgcttc
gtggtggtcctcacgcagagctccatcttcagcctcctggccatcgcgattgaccgctac
attgccatccgtatcccactgcggtacaatggcctggtgacgggcacacgggccaaaggc
atcatcgcagtctgctgggtgctgtcattcgctatcggcctgacgcccatgctgggctgg
aacaactgcggatggccgaaggaagacaggaaccactcacaggcctgcggggcgggccag
gtggcctgcctctttgagtacgtggtacccatgaactatatggtgtactacaacttcttt
gcgtgtgtcttggtgcccctgctgctcatgctgggcgtctacctgcgcatcttcctggca
gcgcggcggcagctgaagcagatggagagccagccagcaccaggcgagcgggcaaggtcc
acactgcagaaggaggtgcatgctgccaagtcactggccatcattgtggggctctttgcc
ctgtgctggctgcccctgcacgtcatcaactgcttcaccttcttctgccccgagtgtgcc
cacgccccgctctggctcatgtacctggccattgtcctctcccataccaactctgtcgtc
aacccgttcatctacgcctaccgcatccgagagttccgccagaccttccgcaagatcatt
cgcagccatgtcttgcggcggcgggagcccttcaaggcgggcggcaccagtgcccgggcc
ctggctgcttatggcagcggtgatggagaacaggtcagcctccgactcaacagccaccct
ctcggcatatgggccaacggcagcgcccccagtcctgagccacggcccaatggctactcc
ctggggttggtgagcagagggggtgccctcgagttccatggggacaagggcctcccagat
gtgagcccagagtctgctggcctagtggctcccctggcccaggatggagcaggcgtgtcc
tga

KEGG   Loxodonta africana (African savanna elephant): 100675139
Entry
100675139         CDS       T04351                                 

Gene name
ADORA2B
Definition
(RefSeq) adenosine receptor A2b
  KO
K04267  adenosine receptor A2b
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04270  Vascular smooth muscle contraction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100675139 (ADORA2B)
   04020 Calcium signaling pathway
    100675139 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100675139 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675139 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    100675139 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100675139 (ADORA2B)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    100675139 (ADORA2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Sri GPR_Gpa2_C
Other DBs
NCBI-GeneID: 100675139
NCBI-ProteinID: XP_023395383
LinkDB
Position
Unknown
AA seq 172 aa
MNESCCPVRCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFTVACKQLQRTELVDH
SRTTLQREIHAAKSLAMIVGIFALCWLPVHAINCVTLFQPALAKDRPKWAMNVAILLSHA
NSVVNPIVYAYRNQDFRYTFHKIISRYILCQTDVLKSRNGQAGAHPAPAVGL
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaatgaaagctgctgccctgtgaggtgtctctttgagaatgtggtccccatgagctac
atggtgtatttcaacttctttggatgtgtcctgcccccactgctcataatgctggtgatc
tacatcaagatcttcacggtggcctgcaagcagcttcagcgcactgagctggtggaccac
tcgaggaccacccttcaacgggagatccatgcggccaaatccctagccatgattgtgggc
atttttgctctgtgctggctaccggtacacgctatcaactgtgttactctttttcagcca
gctctagctaaggataggcccaagtgggcaatgaacgtggccatccttctatcacatgcc
aactcagttgtcaatcccattgtctacgcctatcggaaccaagacttccgctatactttt
cacaaaatcatctcccggtatatcctctgccagacagatgtcctcaagagtaggaatggg
caggcgggagcacatcctgctcccgctgtgggcctatga

DBGET integrated database retrieval system