KEGG   Loxodonta africana (African savanna elephant): 100653832
Entry
100653832         CDS       T04351                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04218  Cellular senescence
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100653832 (TGFB3)
   04350 TGF-beta signaling pathway
    100653832 (TGFB3)
   04390 Hippo signaling pathway
    100653832 (TGFB3)
   04068 FoxO signaling pathway
    100653832 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100653832 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100653832 (TGFB3)
   04218 Cellular senescence
    100653832 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653832 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100653832 (TGFB3)
   05212 Pancreatic cancer
    100653832 (TGFB3)
   05225 Hepatocellular carcinoma
    100653832 (TGFB3)
   05226 Gastric cancer
    100653832 (TGFB3)
   05220 Chronic myeloid leukemia
    100653832 (TGFB3)
   05211 Renal cell carcinoma
    100653832 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100653832 (TGFB3)
   05321 Inflammatory bowel disease
    100653832 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100653832 (TGFB3)
   05414 Dilated cardiomyopathy
    100653832 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100653832 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100653832 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100653832 (TGFB3)
   05161 Hepatitis B
    100653832 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100653832 (TGFB3)
   05144 Malaria
    100653832 (TGFB3)
   05145 Toxoplasmosis
    100653832 (TGFB3)
   05140 Leishmaniasis
    100653832 (TGFB3)
   05142 Chagas disease
    100653832 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100653832 (TGFB3)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100653832 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100653832
NCBI-ProteinID: XP_003408833
LinkDB
Position
Unknown
AA seq 457 aa
MHLLAKPQSSGSGEAAWFSSLLLHVCWGLLLARPRRPPASLPGSHMKMHLQRALVVLALL
NFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSLMTHVPYQVLALYNS
TRELLEEMQGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFN
VSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRG
TSEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDN
EDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENC
CVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSTDTTHSTVLGLYNTLNPEASAS
PCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctggggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctgctcctcgccaggcctcgccgccccccagcctct
cttcccggctcgcacatgaagatgcacttgcaaagggctctggtggtcctcgccctgctg
aactttgccacggtcagcctttctctgtccacttgcaccaccttggacttcggccacatc
aagaagaagagagtggaagccattaggggacagatcttgagcaagctcaggctcaccagt
ccccctgagccatcgttgatgacccatgtcccctaccaggtcctggccctttacaacagc
acccgcgagctgctggaggagatgcagggggaaagggaggaaggctgcactcaggaaaac
actgagtcggaatactatgccaaagaaatccataaattcgacatgatccaggggctggcg
gagcacaatgagctggctgtctgtcccaaaggaatcacctccaaggttttccgcttcaat
gtgtcctcagtggagaaaaatagaaccaacttgttccgagcagaattccgggtcctgagg
gtgcccaaccccagctccaaacgcaatgagcagaggatcgagctcttccagatacttcgg
ccagatgagcacatcgccaaacagcgttatatcggtggcaagaatctgcccacaaggggc
acctctgagtggttgtcttttgacgtcactgacactgtgcgtgagtggctcctgcgaaga
gagtccaacttaggtctggaaattagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaacattcacgaggtgatggaaatcaaattcaaaggtgtggacaat
gaggatgatcatggccgtggagacttggggcgcctcaaaaagcagaaggatcaccacaac
cctcatctaatcctcatgatgattcccccacaccggcttgacaacccaggccagggaggg
cagaggaagaagcgggccctggacaccaattactgcttccgcaacttggaggagaactgc
tgtgtgcgccctctctacattgacttccgacaggacctgggctggaaatgggtccatgaa
cctaagggctactacgcaaacttctgctcaggcccttgcccatacctccgcagtacagac
acaacccacagcacggtgctgggactgtacaacaccctcaatcctgaagcatctgcctca
ccttgttgtgtgccccaggacctggagcccctgaccatcctgtactatgtcgggaggacc
cccaaggtggagcagctctccaacatggtggtcaagtcctgtaagtgtagctga

KEGG   Loxodonta africana (African savanna elephant): 100656534
Entry
100656534         CDS       T04351                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X2
  KO
K13376  transforming growth factor beta-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04218  Cellular senescence
lav04350  TGF-beta signaling pathway
lav04380  Osteoclast differentiation
lav04390  Hippo signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656534 (TGFB2)
   04350 TGF-beta signaling pathway
    100656534 (TGFB2)
   04390 Hippo signaling pathway
    100656534 (TGFB2)
   04068 FoxO signaling pathway
    100656534 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100656534 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100656534 (TGFB2)
   04218 Cellular senescence
    100656534 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656534 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656534 (TGFB2)
   05206 MicroRNAs in cancer
    100656534 (TGFB2)
   05205 Proteoglycans in cancer
    100656534 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100656534 (TGFB2)
   05212 Pancreatic cancer
    100656534 (TGFB2)
   05225 Hepatocellular carcinoma
    100656534 (TGFB2)
   05226 Gastric cancer
    100656534 (TGFB2)
   05220 Chronic myeloid leukemia
    100656534 (TGFB2)
   05211 Renal cell carcinoma
    100656534 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100656534 (TGFB2)
   05321 Inflammatory bowel disease
    100656534 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100656534 (TGFB2)
   05414 Dilated cardiomyopathy
    100656534 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100656534 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100656534 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656534 (TGFB2)
   05161 Hepatitis B
    100656534 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100656534 (TGFB2)
   05144 Malaria
    100656534 (TGFB2)
   05145 Toxoplasmosis
    100656534 (TGFB2)
   05140 Leishmaniasis
    100656534 (TGFB2)
   05142 Chagas disease
    100656534 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100656534 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100656534 (TGFB2)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100656534 (TGFB2)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100656534 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100656534
NCBI-ProteinID: XP_003419925
LinkDB
Position
Unknown
AA seq 414 aa
MHYCVLSAFLVLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQPNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgctttcctggtgctgcatctggtcacggtggcgctgagc
ctgtctacctgtagcacgctcgatatggaccagttcatgcgcaagaggatcgaggccatc
cgcgggcaaatcctcagcaagctgaagctcaccagccccccagaagactaccctgagccc
gacgaggtcccgccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggcgagctgccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtttacaagatcgacatgccgcccttcttcccctccgaaaacgccatcccgccc
actttctacagaccctacttccgaattgtccggttcgatgtctcagcgatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgagcaacggatagaactgtatcagattctgaaatccaaagatttaacctcccca
acccagcgctacatcgacagcaaagtcgtgaaaacaagggctgaaggcgaatggctgtcc
tttgatgtaactgacgctgttcatgaatggcttcaccacaaagacaggaacctgggattt
aaaatcagtttgcactgtccctgctgcacctttgtgccatccaacaattacatcatccca
aataaaagcgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagacttgagtcgcaacagcccaaccggcggaag
aagcgcgccctggatgccgcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatcttgggtggaagtggatacatgaacctaaaggg
tacaatgctaacttctgtgctggagcatgcccatatttgtggagctcggacactcagcac
agtagggtcctcagcttatataataccataaacccagaagcctctgcttctccttgctgc
gtgtcccaggatttagaaccgctaaccattctctactacatcggcaaaacacccaagatt
gagcagctttctaatatgatcgtgaagtcttgtaaatgcagctaa

KEGG   Loxodonta africana (African savanna elephant): 100667634
Entry
100667634         CDS       T04351                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04218  Cellular senescence
lav04350  TGF-beta signaling pathway
lav04380  Osteoclast differentiation
lav04390  Hippo signaling pathway
lav04659  Th17 cell differentiation
lav04672  Intestinal immune network for IgA production
lav04926  Relaxin signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100667634 (TGFB1)
   04350 TGF-beta signaling pathway
    100667634 (TGFB1)
   04390 Hippo signaling pathway
    100667634 (TGFB1)
   04068 FoxO signaling pathway
    100667634 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100667634 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100667634 (TGFB1)
   04218 Cellular senescence
    100667634 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100667634 (TGFB1)
   04672 Intestinal immune network for IgA production
    100667634 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100667634 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100667634 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667634 (TGFB1)
   05205 Proteoglycans in cancer
    100667634 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100667634 (TGFB1)
   05212 Pancreatic cancer
    100667634 (TGFB1)
   05225 Hepatocellular carcinoma
    100667634 (TGFB1)
   05226 Gastric cancer
    100667634 (TGFB1)
   05220 Chronic myeloid leukemia
    100667634 (TGFB1)
   05211 Renal cell carcinoma
    100667634 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100667634 (TGFB1)
   05321 Inflammatory bowel disease
    100667634 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100667634 (TGFB1)
   05414 Dilated cardiomyopathy
    100667634 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100667634 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100667634 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100667634 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667634 (TGFB1)
   05161 Hepatitis B
    100667634 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100667634 (TGFB1)
   05144 Malaria
    100667634 (TGFB1)
   05145 Toxoplasmosis
    100667634 (TGFB1)
   05140 Leishmaniasis
    100667634 (TGFB1)
   05142 Chagas disease
    100667634 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lav03110]
    100667634 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100667634 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100667634 (TGFB1)
Chaperones and folding catalysts [BR:lav03110]
 Intramolecular chaperones
  Others
   100667634 (TGFB1)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100667634 (TGFB1)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100667634 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100667634
NCBI-ProteinID: XP_003420839
UniProt: G3T0F7
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLRLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPNQGEVPPGPLPEAVLALYNSTRDQVAGESAEPEPEPEADYYAKEVTRVLMVESSNKI
YDKLRHGSHSIHMLFNTSELREAVPEPMLLSRAELRLLRQSLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSSEWLSFEVTGVVRQWLSRGGEIEGFRLSTHCSCDDKDNKLQVEIKGLN
NNHRRGDLAAIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctacggctgctagtg
ctgacgccgggccggccggccgcgggtctgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctatccaaactgcgcctcgcc
agtcccccgaaccagggggaggtgccgcccggcccgctgcctgaggccgtgctcgccctc
tacaacagtacccgagaccaagtggccggggagagcgccgagccggagcccgaacccgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaagcagtaacaaaatc
tatgacaaactcaggcatggctcacacagcatacatatgctcttcaacacatcggagctt
cgagaagcagtgcctgaacccatgttgctttcccgggcagagctgcgcctgctgaggcaa
agtttaaaagtggagcagcacgtggagctgtaccagaaatatagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcatcggagtggctgtccttcgaagtc
actggagttgtgcgacagtggctgagccgtggaggggaaatagagggctttcgcctcagc
acccactgctcctgtgatgacaaagacaacaaactccaagtggaaatcaaagggctgaat
aacaaccaccgcagaggtgacctggctgccattcatggcatgaaccggcccttcctgctc
cttatggccacccccttggagagggcccagcacctgcacagctcccggcaccggcgggcc
ctggacaccaactactgcttcagctccaccgagaagaactgctgcgtgcggcagctgtac
atcgacttccgcaaggacctgggctggaagtggatccacgagcccaagggctaccacgcc
aacttctgcctggggccctgcccttacatctggagccttgacactcagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggcaccgtgctgcgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgatcctgcaagtgcagctga

DBGET integrated database retrieval system