KEGG   Loxodonta africana (African savanna elephant): 100653894
Entry
100653894         CDS       T04351                                 

Gene name
SLC12A2
Definition
(RefSeq) solute carrier family 12 member 2
  KO
K10951  solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04970  Salivary secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100653894 (SLC12A2)
   04972 Pancreatic secretion
    100653894 (SLC12A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100653894 (SLC12A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100653894 (SLC12A2)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100653894 (SLC12A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   100653894 (SLC12A2)
SSDB
Motif
Pfam: SLC12 AA_permease AA_permease_N AA_permease_2
Other DBs
NCBI-GeneID: 100653894
NCBI-ProteinID: XP_010588527
LinkDB
Position
Unknown
AA seq 1588 aa
MKAASSVITQNPGPLFSRDCTVIGVDGKPKAKLLVMQGYQLIPQEGVLIVCADLDQQCKC
SYSSTSSPIFGCLLKYAYSGRVRLRLKGFTEEILPSPRHSPIPGPERVRKVAAVRRPEQA
SRVCTARSRLRKRQRARRESPSITRRSEGRRADRARPRRAGEKPRSWWQLAREHLLPARA
EARPAHPLVRQAGRRLQPCGLDCQSTDARPGPRDRREGGARGARFSTPQSGAGEGGGGWV
EDDGRGGSGAEIFPAKVARLLLDRVAHAPRASRGPARLAGRGPCAGGSPVGSLRSPGGLG
AEGASAAHYCGIAGGRAEGRRSRQPRLPRAAARAAAAARLQAGNGESDSLTWRCGRSHRR
PGARRTCSPRRLPGFSRFARWSGGRWSRGPRAPSSGAPRTAGPGETPPAAALTAAGMDLP
GTAVPSAPEDAAAASRGGGGVRGEGVAAAGDGLGRPLGPTPSQSRFQVDLVSESAGRAAA
AAAAAGTGEKETPASGKAVGESGPTKGSEEAKGRFRVNFVDPAATSSADESLSDAAGVAG
DGPNVNFQNGGDTVLSEGSSLHSGGGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVP
RIDHYRHTAAQLGEKLLRPSLAELHDELEKEPFEDGFANGEETTPTRDAVVTYTAESKGV
VKFGWIKGVLVRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVITMATVVTTITGLSTSAIA
TNGFVRGGGAYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILM
IDEINDIRIIGAITVVILLGISVAGMEWEAKAQIVLLVILLLAIADFVIGTFIPLESKKP
KGFFGYKSEIFNENFGPDFRDEETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGT
LLAILITTMVYVGIAVSVGSCVVRDATGNINDTIVTELANCTSAACKLNFDFSSCETGPC
SYGLMNNFQVMSMVSGFAPLISAGIFSATLSSALASLVSAPKIFQALCKDNIYPAFQMFA
KGYGKNNEPLRGYILTFLIALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSP
GWRPAFKYYNMWISLLGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSST
QALTYLSALQHSIRLSGVEDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGH
VHMGPRRQAMKEMSIDQAKYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPN
TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQE
KSPGAKDVVLSMEYSKTSDLGTSKQSGEKTVKDEEEDGKTPTQPLLKKESKGPVVPLNVA
DQKLLEASTQFQKKQGKNTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINR
IDHDRRAMATLLSKFRIDFSDIMVLGDINTKPKKENIVAFDEMIEPYRLHEDDKEQDIAD
KMKEDEPWLITDNELELYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYM
AWLEALSKDLPPILLVRGNHQSVLTFYS
NT seq 4767 nt   +upstreamnt  +downstreamnt
atgaaagctgcctcctctgttataacccaaaatccaggcccactcttcagtcgtgactgt
acagtcattggggttgacggaaagcctaaggccaagctcctggtcatgcaaggctaccaa
ctgattccccaagaaggggtcctgatagtgtgtgctgacttagatcagcaatgtaagtgt
tcctacagctctacatcttcaccaatatttggctgtcttctcaagtatgcctattcaggc
agggtaagactacgcctcaaaggcttcacagaggaaatcctgccgtccccccgccactcc
cccatcccagggccggagcgagttcggaaagtagcggcggttcggcgcccggagcaggcc
tcccgggtctgcacagctcgctcgcgcctccggaagcgccagcgcgcccgacgggaaagc
cccagcatcacccggaggagcgaggggcggcgcgcggatagagcacggcctcggcgagcc
ggcgagaagcccaggagctggtggcagctagcgcgggagcatctgctaccggcgcgcgct
gaagcacgacccgcacaccctttagtccgccaggccgggcgccgtctgcagccgtgtggc
ttggactgccagtccactgacgcacggcccggcccgagggaccgtagagagggaggcgcc
cggggggcccgcttcagtacgccgcagagtggggcgggggaaggaggtggggggtgggtg
gaggacgacggaaggggaggtagcggcgcggagatcttcccggcgaaggtcgcgcgcctg
ctccttgatcgcgttgctcacgctcctcgcgcttcccgaggcccggcgcgcctggctgga
cgcggcccctgcgcgggcggctcccccgtggggtcgcttaggagtcctggaggcttgggc
gcagagggagcgtccgccgcgcactattgcgggatcgcgggtgggcgggctgaggggcgg
aggagccgccagccccgcctcccgcgtgctgcagcccgagcagcagccgccgcgcggctg
caagcgggcaacggggagagcgactccctcacctggcgttgcggccgcagccaccgccgg
ccaggagcgcggaggacgtgtagcccgcgacgtctgccaggcttctccaggttcgcccgg
tggtcaggagggcgatggagccggggcccacgggcgccctcctccggcgccccgaggacg
gcagggcccggggagacgccgccagccgctgcgttgaccgctgcggggatggacctgccc
ggtaccgctgtgccctcagcgccggaggatgctgcggccgctagccggggcggcggcggg
gtccgcggtgagggcgtcgcggcggccggggacgggctgggaagacctctggggcccacc
ccgagccagagccgcttccaggtggacctggtctccgagagcgccgggcgggccgcggct
gccgcagcggcggcggggacgggggagaaggagacccctgcgtcgggaaaggccgttggg
gagagcgggccgaccaagggcagcgaggaagccaagggccgcttccgcgtgaacttcgtg
gatccggccgccacctcgtcggcggacgagagcctgtcggatgcggcgggtgtcgcaggc
gacggacccaatgtgaacttccagaacggcggggacacggtgctgagtgagggcagcagc
ctgcactcgggcggcggcggcggcggcggcagcgggcaccaccagcactattactatgac
acccacaccaacacttactacctgcgcactttcggccacaacaccatggacgcggtgccg
aggatcgaccactatcggcacacggccgcgcagctgggcgagaagctgctccggcccagc
ctggcggagctccacgacgagctggaaaaggaaccttttgaggatgggtttgcaaacggg
gaggaaactactccaacaagagatgctgtggtcacatatactgcggaaagtaaaggagtc
gtgaagtttggttggatcaagggtgtgttagtacgttgtatgttaaatatttggggtgtg
atgctctttattagattgtcatggattgtgggtcaagctggaataggtctgtctgtcctt
gtcataacaatggccactgttgtgacaactatcacaggattgtctacttcagcaatagct
actaacggatttgtaagaggaggaggggcatattatttaatatctagaagtctagggcct
gaatttggtggtgccattggcctgatcttcgcttttgctaatgctgttgcagttgctatg
tatgtggttggatttgcagaaactgtggtggagttgcttaaggaacattccatacttatg
atagatgaaatcaatgatatccgaattattggagcgattacagtggtgatccttttaggt
atctcagtagctggaatggaatgggaagcaaaagctcaaattgttcttttggtgattcta
ctacttgctattgctgatttcgtcataggaacatttatcccattggaaagcaagaagccc
aaaggtttctttggttataaatcagaaatatttaatgagaacttcggaccagattttcga
gatgaagagactttcttttctgtatttgctatcttttttcctgctgcaactggtattctg
gctggagcaaatatctcaggtgaccttgcagatcctcagtcagccatacccaaaggaaca
cttttagccattttaattactacgatggtttacgtaggaattgcagtatctgtaggttct
tgcgttgttcgggatgccactgggaacattaatgacactattgtgacagagttagcaaac
tgtacttctgcggcatgcaaattaaactttgatttttcatcttgtgaaactggtccttgt
tcttatggcctaatgaacaacttccaggtaatgagcatggtgtcaggatttgcaccatta
atctctgcaggtatcttttcagctactctttcttctgcattagcatcccttgtgagcgct
cccaaaatattccaggctctgtgtaaggacaacatctacccagctttccagatgtttgcc
aaaggttatgggaagaacaatgaacctcttcgtggctacatcttaacattcttaattgca
cttggattcatcctaattgctgagctgaatgttattgctccgattatctctaacttcttc
ttagcatcgtatgcattgatcaatttttcagtattccatgcctctcttgcaaaatctcca
ggatggcgccctgcattcaaatactacaacatgtggatatcgcttcttggagcaattctt
tgctgcatagtgatgtttgtcattaactggtgggcggcattgcttacgtatgttatagtc
cttgggctgtacatttatgtcacctacaaaaaaccagatgtgaattggggatcctctaca
caagctctgacttacctgagtgcgttgcagcattcaattcgtctttctggagtagaagac
catgtgaaaaactttaggccacagtgtcttgttatgacaggtgctccaaactcacgccca
gctttacttcatcttgttcatgatttcacaaaaaatgttggtttgatgatctgtggccat
gtacatatgggccctcgaagacaagccatgaaagagatgtccattgatcaagccaaatac
cagcgatggcttattaaaaacaaaatgaaggctttttatgctccagttcatgcagatgac
ttgagagaaggtgcacaatatttgatgcaggctgctggtctcggtcgtatgaaaccaaac
acacttgtccttggatttaagaaagattggttgcaagcagatatgagggatgtggatatg
tatataaatttatttcatgatgcctttgacatccaatatggagtggtggttatccgctta
aaggagggcctggatatatctcatcttcaaggacaagaagaattgctgtcatcacaagag
aagtctcctggtgcaaaggatgtggtactaagtatggaatatagtaaaacatcagattta
ggtacttccaaacaatctggtgaaaaaaccgttaaagatgaggaagaggatggcaagact
ccaactcaaccactgttgaaaaaagaatcgaaaggccctgttgtgcctttaaatgtagct
gaccaaaagctccttgaagctagtacacagtttcagaaaaaacaaggaaagaacactatt
gacgtctggtggctttttgatgatggaggtttgaccttattgataccttatcttctaact
accaagaaaaaatggaaagactgtaagattagagtattcattggaggaaaaataaacaga
atagaccacgaccggagagcgatggctactttgcttagcaagttccggatagacttctcc
gacatcatggtcctaggagatattaataccaaaccaaagaaagaaaatattgtagctttt
gatgaaatgattgagccgtacagacttcatgaagacgacaaagagcaagatattgcagat
aaaatgaaagaagatgaaccgtggctaataacagataatgagcttgaactttataagaca
aagacataccggcagatcaggttaaatgaattattaaaagaacattcaagcacagctaat
attattgtcatgagtctcccagttgcaagaaaaggtgctgtgtctagtgctctctacatg
gcatggttagaagctctatctaaggatctaccaccaatcctcctagtccgagggaatcat
cagagtgtccttaccttctattcttaa

DBGET integrated database retrieval system