KEGG   Loxodonta africana (African savanna elephant): 100653927
Entry
100653927         CDS       T04351                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04114  Oocyte meiosis
lav04217  Necroptosis
lav04261  Adrenergic signaling in cardiomyocytes
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04934  Cushing syndrome
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100653927 (CAMK2G)
   04310 Wnt signaling pathway
    100653927 (CAMK2G)
   04066 HIF-1 signaling pathway
    100653927 (CAMK2G)
   04020 Calcium signaling pathway
    100653927 (CAMK2G)
   04024 cAMP signaling pathway
    100653927 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100653927 (CAMK2G)
   04217 Necroptosis
    100653927 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100653927 (CAMK2G)
   04922 Glucagon signaling pathway
    100653927 (CAMK2G)
   04912 GnRH signaling pathway
    100653927 (CAMK2G)
   04921 Oxytocin signaling pathway
    100653927 (CAMK2G)
   04916 Melanogenesis
    100653927 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100653927 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100653927 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100653927 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100653927 (CAMK2G)
   04728 Dopaminergic synapse
    100653927 (CAMK2G)
   04720 Long-term potentiation
    100653927 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100653927 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100653927 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100653927 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    100653927 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100653927 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653927 (CAMK2G)
   05205 Proteoglycans in cancer
    100653927 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100653927 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100653927 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    100653927 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100653927 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100653927 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100653927 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100653927 (CAMK2G)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100653927 (CAMK2G)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100653927 (CAMK2G)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr SnoaL_3 DUF4440 Pkinase_fungal SnoaL_2 Kdo
Other DBs
NCBI-GeneID: 100653927
NCBI-ProteinID: XP_010587538
LinkDB
Position
Unknown
AA seq 474 aa
MPTFETSKHCVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENL
LLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGV
ILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRIT
ADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLN
KKSDGGVKPQSNNKNSLVNPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDED
LKAAPLRTGNGSSVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNG
DFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGE
DAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgccgacttttgaaacatccaaacattgtgttactgggggagagctgtttgaagacatt
gtggccagagagtactacagtgaagctgatgccagccactgtatacatcagattctggag
agtgttaaccacatccatcagcatgatattgtccaccgggacctgaagccagagaaccta
ctgctggcgagtaaatgtaagggtgccgctgtcaagctggctgattttggcctagccatc
gaagtgcagggagagcagcaggcttggtttggttttgctggcaccccaggttacttgtcc
ccagaggtcttacggaaagatccctatggaaaaccagtggatatctgggcctgcggggtc
atcctgtatatcctcctggtgggataccctcccttctgggacgaggatcagcacaagctg
tatcagcagatcaaggctggagcctatgattttccgtcaccagagtgggacacggtgacc
cccgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgcatcacg
gccgatcaggctctcaagcacccatgggtctgtcaacgatccacagtggcatccatgatg
caccgtcaggagactgtggagtgcttgcgcaagttcaatgcccgaaggaaactgaagggt
gcgatcctcacgaccatgcttgtctccaggaatttttcagctgccaaaagcctattgaac
aagaagtcagatggcggtgtcaagccacagagcaacaacaaaaacagtctcgtaaaccca
gcccaagagcccgcgcccttgcagacggccatggagccacaaaccaccgtggtgcacaat
gctacagatgggatcaagggctccacagagagctgcaacaccaccacagaagatgaggac
ctcaaagctgccccgctccgcactgggaatggcagctcggtgcctgaaggacggagctcc
cgggacagaacagccccctctgcaggcatgcagccccagccttctctctgctcctcagcc
atgcgaaaacaggagatcattaagatcacagaacagctgattgaggctatcaacaatggg
gactttgaggcctacacgaagatttgcgatcctggcctcacttcctttgagcctgaggcc
cttggcaacctggtggaagggatggatttccataagttttactttgagaatctcctctcc
aagaacagcaagcccatccacaccaccatcctgaacccacacgttcacgtcatcggagag
gacgctgcttgcatcgcctatatccgcctcacccagtacatcgatgggcagggccggcct
cgcaccagccagtcggaggagactcgggtctggcaccgccgggatggcaagtggctcaat
gtccactaccactgctcaggggcccctgccgcaccgctgcagtga

KEGG   Loxodonta africana (African savanna elephant): 100658516
Entry
100658516         CDS       T04351                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04114  Oocyte meiosis
lav04217  Necroptosis
lav04261  Adrenergic signaling in cardiomyocytes
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04934  Cushing syndrome
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100658516 (CAMK2B)
   04310 Wnt signaling pathway
    100658516 (CAMK2B)
   04066 HIF-1 signaling pathway
    100658516 (CAMK2B)
   04020 Calcium signaling pathway
    100658516 (CAMK2B)
   04024 cAMP signaling pathway
    100658516 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100658516 (CAMK2B)
   04217 Necroptosis
    100658516 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100658516 (CAMK2B)
   04922 Glucagon signaling pathway
    100658516 (CAMK2B)
   04912 GnRH signaling pathway
    100658516 (CAMK2B)
   04921 Oxytocin signaling pathway
    100658516 (CAMK2B)
   04916 Melanogenesis
    100658516 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100658516 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100658516 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100658516 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100658516 (CAMK2B)
   04728 Dopaminergic synapse
    100658516 (CAMK2B)
   04720 Long-term potentiation
    100658516 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100658516 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100658516 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100658516 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100658516 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100658516 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658516 (CAMK2B)
   05205 Proteoglycans in cancer
    100658516 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100658516 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100658516 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100658516 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100658516 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658516 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100658516 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100658516 (CAMK2B)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100658516 (CAMK2B)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100658516 (CAMK2B)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100658516
NCBI-ProteinID: XP_010596596
LinkDB
Position
Unknown
AA seq 637 aa
MATTVTCTRFTDEYQLYEDISKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLSCLLLACQAQLPSLPPAWRSEQGMLQVV
MVTLVMVVVLVAGNSDSVQEVVVLWVMVVMEVVMVTLVVDGDGDIGGGGGDSGRPLGWLP
PLLSPVPSADQEAQSCLEAGLPTRNRWDPRALELCCPHSGMGDHMSVATALALPENLLLT
SKCKGAAVKLADFGLAIQVQGDQQAWFGFACTPGYLSPEVLRKEAYGKPVDIWACGVILY
ILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHE
ALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPAT
MSTAASGATMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
NPVDGIKESSDSTNTTIEDEDTKARKQEIIKITEQLIEAVNNGDFEAYAKICDPGLTSFE
PEALGNLVEGMDFHRFYFENLLAKNNKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQ
GRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
agcaagggggctttctctgtggtccgacgctgtgtcaaactctgcactggacatgagtat
gcagccaagatcatcaacaccaagaagctgtcggccagagatcaccagaagctggagagg
gaggctcggatctgccgcctgttgaagcactccaacatcgtgcgtctccatgacagcatc
tctgaggaaggcttccactacctcgtctttgacctctcatgtctgctgctggcctgccag
gcccagctgccctcactgccacctgcctggaggagcgagcagggcatgctgcaggtggtg
atggtgacgctggtgatggtggtggtgctagtggcaggtaatagtgattctgtgcaggaa
gtggtggtgttgtgggtgatggtggtgatggaagtagtgatggtgacattggtggtggat
ggtgatggtgacattggtggcggtggtggtgatagtggcaggcccctgggctggcttcct
cctctgctgtctcccgtgcccagtgcagaccaggaggctcagagctgcctggaagctggc
ctgcccaccaggaaccgctgggacccccgtgctctagagctctgctgtccacacagtggc
atgggtgaccacatgtcggtggccacagcattggcactgcctgaaaacctacttctaacc
agcaaatgcaaaggtgctgcagtgaaactggctgactttggtctggccatccaggtgcag
ggggaccagcaggcatggtttgggtttgcttgcacaccagggtacctgtccccagaagtc
cttcggaaggaggcttatggcaagcctgtggacatctgggcgtgcggagtgatcctctac
atcctgctcgtgggctacccgcccttctgggacgaggaccagcacaagctgtaccagcag
atcaaggctggagcctacgacttcccctcccccgagtgggacactgtcactcctgaagcc
aaaaacctcatcaaccagatgctcactatcaacccggcaaagcgcatcacggcccatgag
gctctgaagcacccatgggtctgtcaacgctccacggtggcctctatgatgcacagacag
gagactgtggaatgtctgaagaagttcaatgccaggaggaagctcaagggagccatcctt
accaccatgctggccactcggaacttctcagtgggcagacagaccaccgctcctgccaca
atgtccaccgccgcctccggtgccaccatggggctggtggagcaagccaagagtctactg
aacaagaaggcagatggagtcaagccccagacgaacagcaccaaaaacagtgcggcagcc
accagccccaaggggacgctgcctcctgcagccctggagcctcaaaccaccgttatccat
aaccccgtggacgggattaaggagtcctctgacagcaccaacaccaccatagaggacgaa
gacacaaaagcccgcaagcaggagatcatcaaaatcacggagcagctcatcgaggctgtc
aacaacggcgacttcgaggcctatgcgaaaatctgtgatccaggcctgacctcctttgag
cccgaagctctgggcaacctggtagaagggatggacttccacagattctactttgagaac
ttgctcgccaagaacaacaagccaatccacaccaccatcctgaacccgcacgtgcacgtg
atcggcgaggacgcggcctgcatcgcctatatccgcctcacgcagtacattgatgggcag
ggacggccccgcaccagccagtcagaggagacccgcgtgtggcaccgccgtgacggcaag
tggcagaacgttcacttccactgctcaggcgcgcccgtggccccactgcagtga

KEGG   Loxodonta africana (African savanna elephant): 100663321
Entry
100663321         CDS       T04351                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04114  Oocyte meiosis
lav04217  Necroptosis
lav04261  Adrenergic signaling in cardiomyocytes
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04934  Cushing syndrome
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100663321 (CAMK2D)
   04310 Wnt signaling pathway
    100663321 (CAMK2D)
   04066 HIF-1 signaling pathway
    100663321 (CAMK2D)
   04020 Calcium signaling pathway
    100663321 (CAMK2D)
   04024 cAMP signaling pathway
    100663321 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100663321 (CAMK2D)
   04217 Necroptosis
    100663321 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100663321 (CAMK2D)
   04922 Glucagon signaling pathway
    100663321 (CAMK2D)
   04912 GnRH signaling pathway
    100663321 (CAMK2D)
   04921 Oxytocin signaling pathway
    100663321 (CAMK2D)
   04916 Melanogenesis
    100663321 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100663321 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663321 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100663321 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100663321 (CAMK2D)
   04728 Dopaminergic synapse
    100663321 (CAMK2D)
   04720 Long-term potentiation
    100663321 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100663321 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100663321 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100663321 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    100663321 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100663321 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663321 (CAMK2D)
   05205 Proteoglycans in cancer
    100663321 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100663321 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100663321 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100663321 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100663321 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663321 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100663321 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100663321 (CAMK2D)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100663321 (CAMK2D)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100663321 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100663321
NCBI-ProteinID: XP_010588817
LinkDB
Position
Unknown
AA seq 498 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRVTAAEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAI
NNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSQKPIHTIILNPHVHL
VGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPSC
IPNGKENFSGSTSLWQNI
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgaatatcagcttttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgcatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcaccagaagctggaaagg
gaagccagaatctgccgtcttttgaagcaccccaatattgtgcggcttcatgacagcata
tcagaagagggcttccattacttggtgtttgatttagtcactggtggtgaactgttcgaa
gacatagtggcgagggaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaaaggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcatggtttggttttgctggcacacctggatac
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgc
ggtgtcattctctatatcctgttggtgggatatccacccttttgggatgaagaccaacac
agactctatcagcagatcaaggctggagcttatgatttcccatcaccagagtgggacaca
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
gtcacagccgcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaagtttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacgaggaatttttcagccaagagtttgttg
aagaaaccagatggagtaaaggagtccactgaaagttcaaatacaacaattgaggatgaa
gatgtgaaagcacgaaagcaagagattatcaaagtcactgagcaactgatcgaagcaatc
aacaatggggactttgaagcttacacgaaaatctgtgacccaggccttacggcttttgaa
cctgaagcattgggtaatttagtggaagggatggactttcatcgattctactttgaaaat
gctttgtctaaaagccagaaaccaatccacactattatcctgaacccccatgtacacctg
gtaggcgacgatgctgcctgcatagcttacattaggctcactcagtacatggatggcagc
ggaatgccaaagacaatgcagtcagaagagacccgtgtctggcaccgccgggatggaaag
tggcagaacgttcattttcatcgctcggggtcaccaacagtacccatcaagccatcctgt
attccaaatgggaaagaaaacttctcaggaagcacctctttgtggcaaaacatctaa

KEGG   Loxodonta africana (African savanna elephant): 100671333
Entry
100671333         CDS       T04351                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV isoform X1
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04211  Longevity regulating pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav04925  Aldosterone synthesis and secretion
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100671333 (CAMK4)
   04020 Calcium signaling pathway
    100671333 (CAMK4)
   04024 cAMP signaling pathway
    100671333 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100671333 (CAMK4)
   04925 Aldosterone synthesis and secretion
    100671333 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    100671333 (CAMK4)
   04720 Long-term potentiation
    100671333 (CAMK4)
   04722 Neurotrophin signaling pathway
    100671333 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100671333 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    100671333 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100671333 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100671333 (CAMK4)
   05034 Alcoholism
    100671333 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671333 (CAMK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100671333 (CAMK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100671333 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 100671333
NCBI-ProteinID: XP_003404787
LinkDB
Position
Unknown
AA seq 472 aa
MLKVTVPSCSASSCSSVTASAAPGSGSLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSHGNIQEGHKASRDPSP
IEDGNQDIKAIPEEEKVSGDGAQVSFEGAQAELMREQALGEVKDVDINAAEATKMVPEAP
DDGIEVAEPEIEEGLIEEKLKTVEEAADPKEGQENPDLGLGAQQYDVNLPEY
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcctcggtcaccgccagc
gcggccccagggtcgggaagcctcgtcccagattactggatcgacggctccaacagggac
gctctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaattgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggttctagaactc
gtcacaggaggagagctgtttgacaggattgtggaaaaggggtattacagcgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagttgcttacctacatgaaaatgggatc
gtccatcgtgatcttaaaccagagaatctcctctatgcaactccagccccagatgcacca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgctcccgaaattctcagaggctgtgcctatggacct
gaggtagacatgtggtctgtaggaataatcacctacatcctactttgtggatttgaacca
ttttatgatgaaagaggagatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatcctaagaaacggctgactacctttcaagctctccagcacccgtgggtc
acaggaaaagcagccaattttgtacacatggataccgcacaaaagaagctccaagaattc
aatgcccgccgcaagcttaaggcagcagtgaaggcggtggtggcctcttcccggctggga
agtgccagcagtcatggcaacatccaggagggccacaaggccagccgagacccatccccc
atcgaagatggcaaccaggacatcaaagctattccagaagaagagaaagtttcaggagat
ggggcccaagtgtcatttgagggggcacaggctgagctgatgagggagcaggccttaggg
gaagttaaggatgtagatataaatgctgccgaggccaccaagatggtgccagaagcaccg
gatgatgggatagaggtggctgagccagaaatagaagaaggcctaatagaggaaaagctg
aagactgtggaggaagcagcagaccctaaagaagggcaagaaaaccctgatctgggactt
ggggctcaacagtatgatgtgaacctgccagagtactaa

KEGG   Loxodonta africana (African savanna elephant): 104846071
Entry
104846071         CDS       T04351                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04114  Oocyte meiosis
lav04217  Necroptosis
lav04261  Adrenergic signaling in cardiomyocytes
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04740  Olfactory transduction
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04934  Cushing syndrome
lav04971  Gastric acid secretion
lav05012  Parkinson disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05152  Tuberculosis
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104846071 (CAMK2A)
   04310 Wnt signaling pathway
    104846071 (CAMK2A)
   04066 HIF-1 signaling pathway
    104846071 (CAMK2A)
   04020 Calcium signaling pathway
    104846071 (CAMK2A)
   04024 cAMP signaling pathway
    104846071 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104846071 (CAMK2A)
   04217 Necroptosis
    104846071 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104846071 (CAMK2A)
   04922 Glucagon signaling pathway
    104846071 (CAMK2A)
   04912 GnRH signaling pathway
    104846071 (CAMK2A)
   04921 Oxytocin signaling pathway
    104846071 (CAMK2A)
   04916 Melanogenesis
    104846071 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    104846071 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104846071 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    104846071 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    104846071 (CAMK2A)
   04728 Dopaminergic synapse
    104846071 (CAMK2A)
   04720 Long-term potentiation
    104846071 (CAMK2A)
   04722 Neurotrophin signaling pathway
    104846071 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    104846071 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    104846071 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    104846071 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104846071 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104846071 (CAMK2A)
   05205 Proteoglycans in cancer
    104846071 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    104846071 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104846071 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    104846071 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    104846071 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104846071 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104846071 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    104846071 (CAMK2A)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104846071 (CAMK2A)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104846071 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 104846071
NCBI-ProteinID: XP_010590164
LinkDB
Position
Unknown
AA seq 478 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GSHLTTMLATRNFSVGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRIWHRRDGKWQIVHFHRSGAPSVLPQ
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgattcacggaagagtaccagctcttcgaggaactggga
aagggcgccttctcggtggttcgcaggtgtgtgaaggtgctggccggccaggagtatgct
gccaagatcatcaacaccaagaagctctcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctcttgaagcaccccaacattgtccgactccatgacagcatctct
gaggagggacaccattacctgatcttcgacctggtcactggtggggagctgtttgaagac
atagtggcccgggagtattacagtgaagctgatgctagccactgtatccagcagatcttg
gaggcagtgctgcactgccatcagatgggggtggtgcaccgggacctgaagcctgagaat
ctgctgctggcctccaagctcaagggcgctgcggtgaagctggcggactttggcctggcc
atagaggtggaaggagaacaacaggcgtggttcgggtttgcagggacacctggatacctc
tccccagaagtgctgcggaaggacccttatggaaagcctgtggacctgtgggcctgtggg
gtcatcctgtatatcctgctggttgggtaccctccattctgggatgaggaccagcatcgc
ctgtaccagcagatcaaagctggcgcctatgatttcccatcacccgagtgggacaccgtc
actccggaagctaaggacctgatcaataagatgctgaccattaacccgtccaaacgtatc
acagctgccgaggccctcaaacacccctggatctcgcaccggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactgaag
gggagccatctcaccaccatgcttgccaccaggaacttttcggtagggaagagtggagga
aacaagaagaacgatggtgtgaaggaatcttcggagagcaccaacaccaccattgaggat
gaagacaccaaagtgcggaaacaggaaattataaaagtgacagagcagctgattgaagcc
ataagcaatggagattttgagtcctacacgaagatgtgcgaccctggaatgacagccttt
gaacctgaggctctggggaacctggtcgagggcctggacttccatcgattctattttgaa
aacttgtggtccaggaacagcaagcccgtgcacaccaccatcctgaacccccacatccac
ctgatgggtgacgagtcagcctgcatcgcctacattcgcatcacgcagtatctggacgcc
ggcggcatcccccgcacggcccagtccgaggagacccgcatctggcaccgccgggacggc
aaatggcagattgtccacttccacagatctggggcgccctctgtcctcccgcagtaa

DBGET integrated database retrieval system