KEGG   Loxodonta africana (African savanna elephant): 100653936
Entry
100653936         CDS       T04351                                 

Gene name
SLC32A1
Definition
(RefSeq) LOW QUALITY PROTEIN: vesicular inhibitory amino acid transporter
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04727  GABAergic synapse
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100653936 (SLC32A1)
   04723 Retrograde endocannabinoid signaling
    100653936 (SLC32A1)
   04721 Synaptic vesicle cycle
    100653936 (SLC32A1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100653936 (SLC32A1)
   05033 Nicotine addiction
    100653936 (SLC32A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   100653936 (SLC32A1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 100653936
NCBI-ProteinID: XP_010589982
UniProt: G3U742
LinkDB
Position
Unknown
AA seq 526 aa
MATLLRSKLSNVATSVSNKSQAKVSGMFARMGFQAATDKEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEPPVEGDIHYQRGGGAPLPPSGSKDQTVGAGGEFGGQDKPKITAW
EAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEV
VRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVS
QKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKF
YIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAY
LTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFP
ACYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLR
LLWRKLLWHQVFFDVAIFVIGGICSVSGFIHSLEGLIEAYRTNAED
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgtccaacgtggccacgtccgtgtccaacaagtcc
caggccaaggtgagcggcatgtttgccaggatgggctttcaggcggccacagacaaggag
gcggtgggcttcgcacactgcgatgacctcgactttgagcaccgacagggcctgcagatg
gacatcctgaaagccgagggcgagccctgcggggacgagggcgctgagccgcctgtcgag
ggagacatccattaccagcgcggcggcggcgcgcccctgccgccctcgggctccaaggac
cagaccgtgggggctggtggcgagttcgggggccaagacaagcccaagatcacggcgtgg
gaggcgggctggaacgtgaccaacgccatccagggcatgttcgtgctgggcctgccctat
gccatcctgcacggcggctacttggggttgttcctcatcatcttcgccgctgtcgtgtgc
tgctacaccggcaagatcctcatcgcgtgcctgtacgaggagaacgaggacggcgaggtg
gtgcgcgtgcgggactcttacgtggccattgccaacgcgtgctgtgcgccacgcttccct
acgctgggcggtcgcgtggtaaatgtggcacagatcatcgagctggtcatgacatgcatc
ctgtacgtggtggtgagcggcaacctcatgtacaacagcttcccggggctgccagtgtcg
cagaagtcctggtctatcatcgccacggccgtgctgctgccctgcgccttcctcaagaac
ctcaaggccgtgtccaagttcagcctgctgtgcactctggcccacttcgtcatcaacatc
ctggtcatcgcctactgcttatcgcgggcgcgcgactgggcctgggaaaaggtcaagttc
tatatcgacgtcaagaagttccccatctccattggcatcattgtgttcagctacacgtcg
cagatcttcctgccttcgctcgagggcaacatgcagcagcccagcgagttccactgcatg
atgaactggacgcacatcgccgcttgcgtcctcaagggtctcttcgcgctcgtagcctac
ctcacctgggccgacgaaaccaaggaggtcatcacggataacctgccgggctccatccgc
gccgtggtcaacatattcctggtggccaaggcgctgttgtcctacccgctgcctttcttc
gctgctgtcgaggtgctggagaagtcgctcttccaggagggcagccgcgccttcttcccc
gcttgctacggaggcgacgggcgcctcaagtcgtggggactaacgctgcgctgcgcgctc
gtggtcttcacgctgctcatggccatctacgtgccgcactttgcgctgctcatgggcctc
accggcagccttaccggcgctggcctctgcttcctgctgcccagcctcttccacctgcgc
ctgctctggcgcaagctgttgtggcaccaagtcttcttcgacgttgctatcttcgtcatc
ggcgggatctgcagcgtgtccggcttcatacactctctcgagggcctcatcgaggcgtac
cgaaccaacgcggaggactag

DBGET integrated database retrieval system