KEGG   Loxodonta africana (African savanna elephant): 100653946
Entry
100653946         CDS       T04351                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04350  TGF-beta signaling pathway
lav04371  Apelin signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04931  Insulin resistance
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100653946 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100653946 (RPS6KB1)
   04371 Apelin signaling pathway
    100653946 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100653946 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100653946 (RPS6KB1)
   04152 AMPK signaling pathway
    100653946 (RPS6KB1)
   04150 mTOR signaling pathway
    100653946 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100653946 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100653946 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100653946 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100653946 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100653946 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100653946 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100653946 (RPS6KB1)
   05205 Proteoglycans in cancer
    100653946 (RPS6KB1)
   05231 Choline metabolism in cancer
    100653946 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100653946 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100653946 (RPS6KB1)
   05212 Pancreatic cancer
    100653946 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100653946 (RPS6KB1)
   05226 Gastric cancer
    100653946 (RPS6KB1)
   05221 Acute myeloid leukemia
    100653946 (RPS6KB1)
   05224 Breast cancer
    100653946 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100653946 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100653946 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100653946 (RPS6KB1)
   05165 Human papillomavirus infection
    100653946 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100653946 (RPS6KB1)
   01522 Endocrine resistance
    100653946 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100653946 (RPS6KB1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100653946 (RPS6KB1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100653946 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100653946
NCBI-ProteinID: XP_003414622
UniProt: G3TCW7
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDVRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacgtccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccacgggggagttgga
ccatatgaacttggcatggaacattgtgaaaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgaactacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactggaaaaatattt
gcaatgaaggtgcttaaaaaggccatgatagtaagaaatgctaaagacacagctcataca
aaagcagaacggaatattctggaggaagtaaaacatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagcggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacacagcttgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccataatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaagtgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctaaaaagaaacgctgcttctcgtcttggagctggtcct
ggggatgctggagaagttcaggctcatccattcttcagacacattaactgggaagaactg
ctggctcggaaagtggagcctccttttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtttttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccgcgaacacctgtgagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacgatgagtggggaagcatcagcaccacttccaatacgacag
ccaaactccgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

KEGG   Loxodonta africana (African savanna elephant): 100671034
Entry
100671034         CDS       T04351                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04012  ErbB signaling pathway
lav04066  HIF-1 signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04350  TGF-beta signaling pathway
lav04371  Apelin signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04931  Insulin resistance
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100671034 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100671034 (RPS6KB2)
   04371 Apelin signaling pathway
    100671034 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100671034 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100671034 (RPS6KB2)
   04152 AMPK signaling pathway
    100671034 (RPS6KB2)
   04150 mTOR signaling pathway
    100671034 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100671034 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100671034 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100671034 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100671034 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100671034 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100671034 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671034 (RPS6KB2)
   05205 Proteoglycans in cancer
    100671034 (RPS6KB2)
   05231 Choline metabolism in cancer
    100671034 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100671034 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100671034 (RPS6KB2)
   05212 Pancreatic cancer
    100671034 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100671034 (RPS6KB2)
   05226 Gastric cancer
    100671034 (RPS6KB2)
   05221 Acute myeloid leukemia
    100671034 (RPS6KB2)
   05224 Breast cancer
    100671034 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100671034 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100671034 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100671034 (RPS6KB2)
   05165 Human papillomavirus infection
    100671034 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100671034 (RPS6KB2)
   01522 Endocrine resistance
    100671034 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671034 (RPS6KB2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100671034 (RPS6KB2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100671034 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100671034
NCBI-ProteinID: XP_003419447
LinkDB
Position
Unknown
AA seq 483 aa
MAAVFDLDLETEEGSEGEGEPELSPADVCPLAELRSAGLEPVGHYEEVELTETSVNPGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELVYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIVKGKLVLPPYLTPDARDLV
KKFLKRNPSQRIGGGAGDGADVQRHPFFRHIHWDDLLARRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDSALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPTLPPLLPPPPPPSSTAPLPIRPPSGTKKSKRGRGH
SGR
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggcagctgtgttcgacctggacctggagaccgaggagggcagcgagggcgagggcgag
ccagagctcagccccgcggacgtgtgtccccttgccgagttgaggtcggctggcctggag
cctgtgggacactatgaggaggtggagctgaccgagaccagcgtcaaccccggccctgag
cgcattgggccccactgctttgaactgctgcgtgtactgggcaaggggggctatggcaag
gtgttccaggtgcgaaaagtacaaggtaccaacttggggaaaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgcgtaatgctaaggacacagcacacacacgggcagagcgg
aacattctagagtctgtgaagcaccccttcattgtggagctggtctatgccttccagact
ggtggcaagctctacctcatcctggagtgcctcagtggcggcgagctcttcacacatctg
gagcgagaaggcatcttcctggaggacacagcttgcttctacctggcagagatcactctg
gccctcggccacctgcactcccaaggcatcatctaccgcgacctcaaacctgagaacatc
atgctcaacagtcaggggcacatcaagctgacagactttggactctgcaaggagtcgatt
catgagggtgctgtcacccacaccttctgtggcaccatcgagtacatggccccagagatt
ctggtacgcagtggccacaaccgagcggtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccacccttcaccgcagagaaccggaagaaaaccatggacaag
atcgtcaaggggaagctagtgctgcccccctacctcaccccagacgcccgggacctcgtc
aaaaagtttctgaagcggaatcccagccagcggattgggggtggcgcaggggatggcgct
gacgtgcagaggcaccccttcttccggcacatccactgggacgacctcctagcccgccgt
gtggaccctcccttcaggccctgtctgcagtcagaggaggatgtgagtcagtttgacacc
cgtttcacgcggcagacgccagtggacagtcctgacgactcagccctcagtgagagtgcc
aaccaggctttcctgggcttcacgtacgtggcaccttccgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctcccccaggcggctcaacagcagcccccggacc
cccatcagccccctgaagttctccccctttgaggggttccggcccagccctggcccaccg
gagcccatggagccaactctacctccactcctgccaccaccaccaccaccctcgagcact
gcccccctccctatccgtcccccctcaggaaccaagaagtccaagaggggccgtgggcac
tctgggcgctag

DBGET integrated database retrieval system