KEGG   Loxodonta africana (African savanna elephant): 100653975Help
Entry
100653975         CDS       T04351                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00040  Pentose and glucuronate interconversions
lav00051  Fructose and mannose metabolism
lav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100653975 (SORD)
   00051 Fructose and mannose metabolism
    100653975 (SORD)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100653975 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Pyr_redox_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 100653975
NCBI-ProteinID: XP_010597986
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MAAAATPENLSLVVHGAGDLRLENYPIPEPGPNEALLKMHSVGICGSDVHYWQHGRIGDF
VVKKPMVLGHEASGTVIKVGPLVKHLKPGDRVAIEPGAPRETDEFCKIGRYNLSPSIFFC
ATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGDKVFVCG
AGPIGLVTLLVAKAMGAAQVVVTDLSASRLSKAKEVGADHTLQVSKESPREIASKVESLL
GCKPEVTIECTGAEAAIQAGIYATRSGGTLVLVGMGPEMTTVPLVHAATREVDIKGVFRY
CNTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSRKGLGLKVMLKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccacacccgagaacctgtccctggtggtgcacggagccggggacctg
cgcctggaaaactaccctatccctgaaccaggcccaaatgaggcgctgctgaagatgcat
tcagttggtatctgtggctcagatgtccactactggcagcacggtcgaattggggatttc
gttgtgaaaaagcccatggtgctggggcacgaagcttcgggaacagtcatcaaagtcgga
ccgctggtaaagcacctgaaaccaggggaccgtgttgctattgagcctggtgctccccga
gaaactgatgagttctgcaagattggccgatacaacctgtcaccatccatcttcttctgt
gccacgccccccgatgacggaaacctctgccgcttctacaagcacaatgccaacttctgc
tacaagcttcctgacaatgtcacctttgaggaaggggccctgattgagccgctatctgtg
gggatccatgcctgccggcgagctggagtcaccctgggcgacaaggtctttgtgtgtgga
gctgggccaattggactggtcactttgcttgtagccaaggcaatgggagcagctcaagtg
gtggtgactgatctgtctgcctctcggttgtccaaagccaaggaagtcggggcagatcac
accctccaagtctccaaagagagccctcgggaaattgccagtaaagtggaaagtctgcta
gggtgcaagcctgaagtcaccatcgagtgcacaggggcggaggccgccatccaggcgggc
atctatgcaacacgttctggtgggaccctggtgctcgtggggatgggccccgagatgacc
actgtgcccttggtgcacgcagccacccgggaagtggacatcaagggcgtgtttcgatac
tgcaacacgtggccaatggcgatttcaatgcttgcatccaagtctgtgaatgttaagccc
ttagtcacccataggtttcctctggagaaagctctggaagcctttgaaacatccagaaag
gggttggggttgaaagtcatgctcaagtgtgaccccaacgaccaaaatccctga

DBGET integrated database retrieval system