KEGG   Loxodonta africana (African savanna elephant): 100653996
Entry
100653996         CDS       T04351                                 

Gene name
CACNB3
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-3 isoform X4
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100653996 (CACNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100653996 (CACNB3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100653996 (CACNB3)
   04261 Adrenergic signaling in cardiomyocytes
    100653996 (CACNB3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100653996 (CACNB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100653996 (CACNB3)
   05414 Dilated cardiomyopathy
    100653996 (CACNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100653996 (CACNB3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100653996 (CACNB3)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Other DBs
NCBI-GeneID: 100653996
NCBI-ProteinID: XP_003405799
UniProt: G3TCU2
LinkDB
Position
Unknown
AA seq 484 aa
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGTLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDITFIPS
PQRLESIRLKQEQKARRSGNPSSLSDTGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPSPGLLGPPTAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSHQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHIDRNWQRNRPWP
KDSY
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagctgactcc
tataccagccgcccatctctggactcggacgtctccctggaagaggaccgggagagtgcc
cggcgcgaagtggagagccaagctcagcagcagctcgagagggccaagcacaagcccgtg
gcatttgctgtgaggaccaatgtcagctactgtggcacactggatgaggagtgcccagtc
cagggctctggagtcaactttgaggccaaagattttctgcacattaaagagaagtacagc
aatgactggtggattgggcggctagtgaaagagggcggagacatcaccttcatccccagc
ccccagcgcctggagagcatccgcctcaaacaggagcagaaggccaggagatccgggaac
ccctccagcctgagtgacactggcaaccgacgctcccctcccccatctctagccaagcag
aagcaaaagcaggcggaacatgttcccccatatgacgttgtgccctccatgcggcctgtg
gtgctggtggggccctctctgaaaggttatgaggtcacagacatgatgcagaaggctctc
ttcgactttctcaaacataggtttgatggcaggatctccatcacccgtgtcacagctgac
ctctcactggcaaagcgatctgtgctcaacaatcctggcaagaggaccatcatagaacgt
tcctctgcccgctccagcatcgccgaagtacagagtgagattgagcgcatattcgagctg
gccaaatccctgcagctggtagtattggatgctgacaccatcaaccacccagcacagctg
gccaagacctcattggcccccatcattgtctttgtcaaagtatcctcaccaaaggtactc
cagcgtctcatccgctcccgggggaagtcacagatgaagcacctgaccgtacagatgatg
gcatatgataagctggttcagtgtccaccggagtcatttgatgtgattctggatgagaac
cagctggaggatgcctgtgagcacctggctgaatacctggaggtttattggcgggccacc
caccacccagcccccagccctggtcttttgggccctcccactgccatccctggacttcag
aaccagcagctgctgggggagcgtggtgaggaacactcaccactcgagcgggacagcttg
atgccctcagatgaggccagcgagagctcacaccaagcctggacaggatcttcacagcgt
agctcccgccacctagaagaggactatgcagatgcctaccaggacctgtaccagccacac
cgccaacacacctcggggctgcccagtgctaacgggcatgacccccaggaccggctccta
gcccaggactcggagcacaaccacattgaccggaactggcagcgcaaccggccctggccc
aaggatagctactga

KEGG   Loxodonta africana (African savanna elephant): 100656938
Entry
100656938         CDS       T04351                                 

Gene name
CACNB4
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-4
  KO
K04865  voltage-dependent calcium channel beta-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656938 (CACNB4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100656938 (CACNB4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100656938 (CACNB4)
   04261 Adrenergic signaling in cardiomyocytes
    100656938 (CACNB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100656938 (CACNB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100656938 (CACNB4)
   05414 Dilated cardiomyopathy
    100656938 (CACNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656938 (CACNB4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100656938 (CACNB4)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Other DBs
NCBI-GeneID: 100656938
NCBI-ProteinID: XP_003405892
LinkDB
Position
Unknown
AA seq 502 aa
MDVVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDREAIRQERE
QQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWI
GRLVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTS
TAKQKQKVTEHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITR
VTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINH
PAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVI
LDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRM
RHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYPDSYQD
TYKPHRNRGSPGGYSHDSRHRL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggatgtggtggcccgaggcaccacgacccggaggagcaggttgaaaagatccgatggc
agcaccacttcgaccagcttcatcctcagacagggttcagcggattcctacacaagcagg
ccctctgactctgatgtctctttggaggaggaccgggaagccattcggcaggaaagagag
cagcaagcagccatccagcttgagagagcaaagtccaaacctgtagcatttgctgtgaag
acgaacgtgagctactgtggtgccctggacgaggatgtgcctgtcccaagcacagccatt
tcctttgatgccaaggactttctacacattaaagagaaatataacaatgattggtggata
ggaaggctggtgaaagagggctgtgagattggtttcatcccaagtccgcttagattggag
aacattcggattcagcaagaacaaaaaagaggacgttttcacggagggaaatcaagtgga
aattcttcttcaagtcttggagaaatggtatcagggacgtttagagcaacacccacatca
acagcaaaacagaagcaaaaagtgacggagcacattcctccttacgatgttgtgccatca
atgcgtccagtggtgttagtggggccgtcactgaagggttatgaggtaacagacatgatg
cagaaagccctctttgatttcctgaagcacaggtttgacgggaggatatcaatcaccaga
gtgaccgctgacatttctcttgctaagaggtctgtcctaaataatcccagcaagagagca
ataattgaacgttcgaacacccgatccagcttagccgaagtacagagtgaaattgaaaga
atctttgagttggcaagatctttgcaactggttgttcttgatgcagacaccatcaatcac
ccagcacaacttataaagacttccttagcaccaattattgtccatgtaaaagtctcatct
ccaaaggttttgcagcggttgattaaatctagaggaaagtcccaaagtaaacacttaaat
gttcaactggtggcagctgataaacttgcacagtgtcccccagaaatgtttgatgttata
ttggatgaaaatcagcttgaggatgcgtgtgaacacctgggagagtaccttgaggcatac
tggcgtgctacccacaccaccagtagcacccctatgactcctctgcttggaaggaattta
ggttcaacagcactctcaccgtatcctacagcaatttctgggttacagagtcagcgtatg
aggcacagcaaccactccacagagaactctccaattgaaaggcgaagtttaatgacctct
gatgaaaattatcacaatgaaagggctcggaagagtaggaaccgcttgtcttccagttcc
caacacagccgagatcattaccctcttgtggaagaagattaccctgactcataccaggac
acttacaaaccccataggaaccgaggatcacctgggggatatagccatgactcccgacac
aggctttga

KEGG   Loxodonta africana (African savanna elephant): 100659138
Entry
100659138         CDS       T04351                                 

Gene name
CACNA2D3
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent calcium channel subunit alpha-2/delta-3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659138 (CACNA2D3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100659138 (CACNA2D3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100659138 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    100659138 (CACNA2D3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100659138 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100659138 (CACNA2D3)
   05414 Dilated cardiomyopathy
    100659138 (CACNA2D3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659138 (CACNA2D3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100659138 (CACNA2D3)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 VWA dCache_1 VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE Phage_holin_6_1
Other DBs
NCBI-GeneID: 100659138
NCBI-ProteinID: XP_003409884
LinkDB
Position
Unknown
AA seq 1144 aa
MKTLIPSIAKKTNRKPAAQDSPRRFEGSQHGRPRLECCASRGASALLAXVLLYAALGEVV
RSEQQIPLSVVKLWASAFGGEIKSIAAKYSGSQLLQKKYKEHEKDVAIEEIDGLQLVKKL
AKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERDKDGNFLELGKE
FILAPNDHFNNLPVNISLSVVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIW
QYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLR
LTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLF
AKGIGMLDIALNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTYDTIFAKYNWPDRKVR
IFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVV
WTEAYIDSTLPQAQKLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLK
TIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVL
RNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRG
NVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRRLSQLEAIKLYLKGKEPLLQCDKELI
QEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDF
LKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGTVNKSNVVTASTSIQLLDERK
SPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEGY
TQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAHGLLDPYNAFLATV
KWIMTELVLFLVEFNLCSWWHSDMTARAQKLKQTLEPCDTEYPAFVSERTIKETTGNIAC
EDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRYNESLKCERLKAQKIRRR
PESCHGFHPEENARECGGALSVHAQQALLLLSAAFDAVVKVTLTEMFSWHAKSWINCEPK
YGAT
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgaaaacactaatcccttccatcgccaagaaaacaaacaggaaacccgcagctcaggac
tccccccggcgcttcgaagggagccagcatggacggccccggctggagtgctgcgcgtcc
cggggggcctcggcgctgctggccnccgtgcttctctacgccgccctgggggaagtggtg
cgctccgagcagcagatcccgctttctgtggtgaagctctgggcctcggcttttggtgga
gagataaaatccatcgctgctaagtactcaggctcccagctactgcaaaagaaatacaaa
gaacacgagaaagacgttgccatagaggaaatcgatggcctccaacttgtgaaaaagctg
gcaaagaacatggaggagatgtttcacaaaaagtctgaagcagtacggcgtcttgtggag
gctgcagaggaagcacacctgaagcatgaatttgatgcagacctgcagtatgaatacttc
aatgctgtgctgatcaacgagagggacaaagacgggaactttttggagctggggaaggaa
ttcatcttagctcctaatgaccattttaataatttgcctgtgaacatcagtctgagtgtt
gtccaagtgccaacgaacatgtacaacaaagacccagcaattgtcaatggtgtttactgg
tccgaatccctgaacaaagttttcgtagataactttgaccgagacccctctctcatatgg
cagtactttggaagcgcaaagggctttttcaggcagtacccagggattaaatgggaacca
gatgagaatggagtgattgcctttgactgcaggaaccgaaaatggtacattcaggcagcc
acttctccaaaagacgtggtcattttagtggatgtcagtggcagcatgaaaggactccgt
ctgaccattgcaaagcagacggtgtcatctatcttggatacgctgggagatgacgacttc
ttcaacataattgcgtataatgaggagcttcactatgtggaaccttgcctgaatggaacg
ttggtacaagctgacaggacgaacaaagagcacttcagggagcatctggacaaacttttt
gccaagggaatcggaatgctggatatagctctcaacgaggccttcaacatcctcagtgac
ttcaatcacacaggacaaggaagtatctgcagccaagcgatcatgctcataactgatggg
gcggtggacacctatgataccatctttgccaaatacaactggccagatcgaaaggttcgc
atcttcacgtacctcattggacgagaggccgcgtttgcagacaacctcaagtggatggcc
tgtgccaacaaaggatttttcacccagatctccaccttggccgacgtgcaggaaaatgtc
atggagtacctccatgtgctcagccggcccaaagtcatcgaccaggagcacgatgtggta
tggaccgaagcttacatcgacagcactctccctcaggcacaaaagcttgctgacgatcag
ggcctcgtcctgatgaccacagtggccatgcctgtgtttagtaagcagaacgaaaccaga
tcaaaaggcattcttctcggtgtggttggcacagatgtcccagtgaaagaacttctgaaa
accatacccaaatacaagttagggattcacggttatgcctttgcaatcacaaataatgga
tacattctgacgcatccagaactcaggccgctgtatgaagaaggaaaaaagcgaaggaaa
cctaactatagtagcgttgacctctctgaggtcgagtgggaagacagagacgacgtgtta
agaaacgccatggtgaatcggaagacaggcaagttttccatggaggtgaagaagacagtg
gacaaagggaaacgggttttggtgatgacaaatgactactattatacagacatcaagggt
actcctttcagtttaggtgtggcgctctccagaggccatgggaaatatttcttccgaggg
aatgtaaccattgaagaaggccttcacgacctagaacaccctgatgtgtccttggcagat
gaatggtcctactgcaacactgacctacacccagaacaccgtcgtctgtcacagttagaa
gctattaagctctacctcaaaggcaaagaacctctgctccaatgtgataaagagctgata
caagaagtcctctttgatgctgtggtgagtgctccaattgaagcgtattggaccagtctt
gccctcaacaaatctgagaattctgacaagggcgtggaggttgccttcctcggtactcgc
actggcctctcgagaatcaacctgtttgttggtgctgagcagctcaccaatcaggacttc
ctgaaagctggagacaaggagaacatttttaacgcagaccactttccgctctggtataga
agagctgcggagcagattcctgggagctttgtctactcgattccgttcagcacaggaaca
gtcaacaaaagtaatgtggtgacagcaagtacctccatccagcttctagacgagcggaaa
tctcccgtggtggcagctgtaggcattcagatgaaacttgaatttttccaaaggaagttc
tggactgccagcagacagtgtgcctctctggatggcaaatgctccatcagctgcgatgat
gagactgtgaactgttacctcatagacaacaacggatttattctggtgtcagaaggctac
acacagactggagactttttcggtgaggtcgagggtgctgtgatgaataaattgttaaca
atgggctcctttaaaagaattaccctttatgattaccaagccatgtgcagagctaacaag
gaaagcagcgatggcgcccatggtctactggatccttataatgccttcctcgctacagta
aaatggataatgacagaacttgtcttgttcctggtggaatttaacctctgcagttggtgg
cactcggacatgacagctagagcccagaaattgaaacagaccctggagccttgtgacact
gaataccccgcatttgtctctgagcgcaccatcaaggagaccacagggaacattgcttgt
gaagactgctccaagtcctttgtcatccagcaaatcccaagcagcaatctgttcatggtg
gtggtggatagcagctgcctgtgtgagtctgtggcccccatcaccatggcgcccattgaa
atcaggtataatgaatcccttaagtgtgagcggttaaaggcccagaagattagaagacgt
ccggaatcttgtcatggctttcatcctgaggagaacgcaagggagtgtggaggtgcactg
agcgttcacgcccagcaggcccttctactgctctccgctgcttttgatgctgttgtcaag
gtgacactgacggagatgttctcttggcatgctaaatcatggataaactgtgaaccaaaa
tatggtgcgacatag

KEGG   Loxodonta africana (African savanna elephant): 100659992
Entry
100659992         CDS       T04351                                 

Gene name
CACNA1D
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04218  Cellular senescence
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04713  Circadian entrainment
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04930  Type II diabetes mellitus
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659992 (CACNA1D)
   04020 Calcium signaling pathway
    100659992 (CACNA1D)
   04024 cAMP signaling pathway
    100659992 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    100659992 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100659992 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100659992 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100659992 (CACNA1D)
   04929 GnRH secretion
    100659992 (CACNA1D)
   04912 GnRH signaling pathway
    100659992 (CACNA1D)
   04921 Oxytocin signaling pathway
    100659992 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    100659992 (CACNA1D)
   04924 Renin secretion
    100659992 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    100659992 (CACNA1D)
   04927 Cortisol synthesis and secretion
    100659992 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100659992 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    100659992 (CACNA1D)
   04270 Vascular smooth muscle contraction
    100659992 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100659992 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100659992 (CACNA1D)
   04727 GABAergic synapse
    100659992 (CACNA1D)
   04725 Cholinergic synapse
    100659992 (CACNA1D)
   04728 Dopaminergic synapse
    100659992 (CACNA1D)
   04726 Serotonergic synapse
    100659992 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    100659992 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100659992 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100659992 (CACNA1D)
   05020 Prion disease
    100659992 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    100659992 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100659992 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100659992 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100659992 (CACNA1D)
   05414 Dilated cardiomyopathy
    100659992 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100659992 (CACNA1D)
   04934 Cushing syndrome
    100659992 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100659992 (CACNA1D)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100659992 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 100659992
NCBI-ProteinID: XP_023403870
LinkDB
Position
Unknown
AA seq 2168 aa
MMMMMMMKKMQHQRQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAAR
QAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACIS
IVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKII
AYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSGGKSGGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKTC
FFADSDIVAEEDPAPCAFSGNGRQCTANDTECKSGWVGPNGGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSG
EGENQGCCASLWCWWKRRGAAKAGPSGCRRWSGLLSGFRSRRWRRWNRFSRRRCRAAVKS
VTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAY
FVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVAS
LLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQIL
TGEDWNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGWSFCIYFIILFIGGNYIL
LNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKV
TIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIIPIPEG
SAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFD
YAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKIL
RVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYR
CTDEAKSNPEECRGLFILYKDGEVDNPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGW
PALLYKAIDSNGENVGPIYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEY
KNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLA
MQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFKPKHYFTDAWNTFDALIVVGSVVD
IAITEVNPTESENVPVPTAAPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTF
IKSFQALPYVALLIAMLFFIYAVIGMQMFGKVALRDNNQINRNNNFQTFPQAVLLLFRCA
TGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQHPXGFGKLCP
HRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEVVPPAGDDEVTVGKFYATFL
IQDYFRKFKKRKEQGLVGKHPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEEAN
REEEDLFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPA
GNSVCHNHHNHNSIGKQIPNSTNANLNNANMSKAAHGKRPSIANLEHVSDNGHHSSHKHD
REPQRRSSFKRTRYYETYVRSDSGDEQLPTICWEDSEIHGYFQDPRCLGEQEYFSSEEYY
EDDSSPTRSRHNNGYYNRYPGSSLDFERPRGYHHPQGFLEDDDSPVCYDRRSPRRRLLPP
TPTSHRRSSFNFECLRRQGSQEEVPPSPAFPHRTALPLHLMQQQIMAVAGLDSSKVQKYS
PSHSTRSWATPPATPPYQDWTPCYTPLIQVERSESLDQVNGSLPSLHRSSWYTDEPGIAY
RTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACD
LTIDEMESAASHLLNGNVSPRANGDVGPVSHQQDYELQDFGSGYSDEEPDPGRYEEDLAD
EMICITTL
NT seq 6507 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcaagcggaccacgcg
aatgaggcaaactatgcaagaggcaccagactccctctttctggtgaaggaccaacttct
cagccgaatagctccaagcagactgtcctgtcttggcaagctgcaatcgatgctgctaga
caggccaaggctgcccaaactatgagcacctccgcgcctccacctgtaggatctctctcc
caaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtccaacagccga
cctgcccgtgcccttttctgtttatcactcaataaccccatccgaagagcctgcattagt
atagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgtgtg
gccttagctatttacatcccattccctgaagatgattctaattcaaccaaccataacttg
gaaaaagtagaatatgccttcctgattatttttacagtcgagacatttttgaagattata
gcttatggattattgctacatcctaatgcttatgttaggaatggatggaatttattggat
tttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaaaca
gaaggcggtaaccactctggtggcaaatcaggaggctttgatgtcaaagccctccgcgcc
tttcgagtgttacgaccacttcgactagtatcaggagtgcccagtttacaagttgtcctg
aactccattataaaagccatggttcccctccttcacatagcccttttggtattatttgta
atcataatctatgctattataggattggaactttttattggaaaaatgcacaaaacatgc
ttttttgctgactcagatatcgtagctgaagaggacccagcgccatgtgcgttctcaggg
aatggacgccagtgtaccgccaatgacacagagtgtaagagtggctgggttggcccaaat
ggaggcatcacaaactttgataactttgcctttgccatgctcaccgtgtttcagtgtatc
accatggagggctggacagacgtgctctactggatgaatgatgctatgggatttgaattg
ccctgggtgtattttgtcagtctcgtcatctttgggtcatttttcgtactaaatcttgta
cttggtgtattgagcggagaattttcaaaggaaagagagaaggctaaagcacggggagat
ttccagaagctccgggagaagcagcagctagaagaggatcttaagggctacttggattgg
attacccaagcagaagacatcgatcctgagaatgaggaagaaggaggagaggaaggcaaa
cgaaatactagcatgcccaccagtgagaccgagtctgtgaacacggagaacgtaagcggc
gaaggcgagaaccaaggctgctgtgcaagtctctggtgctggtggaagagaagaggcgcg
gccaaggctgggccttcagggtgtcggcgctggagtgggctgctctcaggcttcagatcc
cgacgctggcgtcgctggaatcgattcagtcgaagaagatgtagggctgccgtgaagtct
gtcacgttttactggctggttattgtcctggtgtttctcaacaccttaaccatttcctct
gagcactacaaccagcctgactggttgacacagattcaagatatcgctaacaaagtcctc
ttggctctgttcacctgtgagatgttggtaaaaatgtacagcttgggactccaggcgtat
ttcgtctctcttttcaatcggtttgattgcttcgtggtgtgtggtggaattaccgaaact
attttagtggaactggaaatcatgtctcccctgggaatctccgtgtttcggtgtgtgcgc
cttttaagaattttcaaagtgaccaggcactggacttccctcagcaacctcgtggcgtcc
ttgttaaactccatgaagtccatcgcttcactgctgcttctgctctttctcttcatcatc
atcttttccttacttgggatgcagctgtttggcggcaagtttaattttgatgaaacgcaa
accaagcggagtacttttgacaatttccctcaagcgcttttaacagtgttccagatcctg
acaggtgaagactggaatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntc
cagggatggtcgttctgcatctacttcatcatccttttcattggcggtaactatattctg
ttgaatgtcttcttggccatcgccgtggacaatttggctgacgctgaaagtttgaacact
gctcagaaagaggaagcagaagaaaaagagcggaaaaagattgccagaaaagagagcctg
gaaaataaaaagaacaacaaaccagaagtcaaccagatagccaacagtgacaacaaggtt
acaattgatgactaccgagaagaggatgaggacaaggacccctacccaccttgtgatgtg
ccagtaggggaagaggaagaggaggaggaagaggatgaacccgaggtccctgctggtccc
cgtcctcgcagaatctcagagttaaacatgaaggagaaaatcattcccatccctgaagga
agcgctttcttcattcttagcaagaccaacccgatccgcgtgggctgccacaagctcatc
aaccaccacatcttcactaaccttatcctggtcttcatcatgctgagcagcgctgccctc
gcggccgaggaccccatccgcagccactccttccggaacactatactgggttactttgac
tatgctttcacagccatctttactgttgaaatcctgttgaagatgacgacttttggagct
ttcctccacaaaggggctttctgcaggaactacttcaatttgctggatatgctggttgtt
ggggtgtctctggtgtcatttgggattcaatccagcgctatctccgttgtgaagattctg
agggtcctaagggtcctcaggcccctcagggcaatcaacagagcaaaaggacttaagcat
gttgtccagtgtgtctttgtggccatccggacaatcggcaacatcatgatcgtcaccacc
cttctccagttcatgtttgcctgtattggggtccagttgttcaagggaaagttctatcgc
tgcacagatgaagccaaaagtaaccctgaagaatgcagggggcttttcattctctacaag
gatggggaggtcgataaccctgtggtgcgtgagaggatctggcagaacagtgatttcaat
tttgacaacgtcctatctgctatgatggcacttttcacagtctccacatttgagggctgg
cctgcattgctgtataaagctattgactcaaacggtgagaacgtcggcccgatctacaac
taccgcgtggagatctccatcttcttcatcatctacatcatcattgtggctttcttcatg
atgaacatctttgtgggtttcgtcatcgttacgtttcaggagcagggagaaaaagagtat
aagaactgtgagctggacaaaaatcagcgtcagtgcgttgaatatgccttgaaagctcgt
cctttgcggagatacatcccgaaaaacccctaccagtacaagttctggtacgtggtgaac
tcctcgcctttcgaatacatgatgtttgtcctcatcatgctcaacacactctgcttggcc
atgcagcactatgagcagtctaagatgtttaatgacgccatggacatcctgaacatggtc
ttcactggggtgttcaccgttgagatggttttaaaagtcattgcatttaaacctaagcac
tatttcactgatgcatggaacacttttgatgccttaattgttgttggtagcgtcgttgat
attgctataactgaagtgaatccaactgaaagtgaaaatgtccctgtcccaactgctgca
cctgggaactctgaagagagcaatagaatctccatcacctttttccgtcttttccgagtg
atgcgactggtgaagcttctcagcaggggagaaggcatccggacattgctgtggactttt
attaaatcctttcaggccctcccatatgtcgcccttctcatagccatgcttttcttcatc
tatgctgtcatcggaatgcagatgtttgggaaagttgccctgagagataacaaccagatc
aataggaataataacttccaaacctttccccaggcggtactgctgctcttcaggtgtgcc
actggggaggcctggcaggaaatcatgctggcctgcctccctgggaagctgtgtgaccca
gagtcagattacaaccccggggaggagtacacgtgcgggagcaattttgccatcgtttat
ttcatcagtttttacatgctctgtgcatttctgatcatcaatctgtttgtggccgtcatc
atggacaactttgattatctgacccgggactggtctattttgggacctcaccatttagat
gaattcaaacgaatatggtcagaatatgaccctgaagcaaagggaaggataaaacacctg
gacgtggtcactctgcttcgacgtatccagcaccctnnggggtttgggaaattatgccca
cacagagtagcatgcaagagattagttgctatgaacatgcctctcaacagtgatgggaca
gtcatgttcaatgcaaccctgtttgccttggttcgaactgctcttaaaatcaagactgaa
gttgtccctccagctggtgatgatgaggtaaccgtggggaagttctatgccactttcctg
atacaggactactttaggaaattcaagaaacggaaagaacaaggactggtgggaaaacac
ccagcgaagaacaccacaattgccctacaggcgggattaaggacactacacgacattggg
ccagaaatccggcgggctatatcctgtgatttgcaagatgatgagccagaagaagcaaac
cgagaagaagaagatttgttcaaaagaaatggtgccctgcttggaaaccatgtcaatcat
gttaatagtgataggagagattcccttcagcagaccaataccacccaccgtcccctgcat
gtccaaaggccttcaattccacctgcaagtgatactgagaaaccgctgtttcctccagca
ggaaattcggtgtgtcataaccatcataaccataattccataggaaagcaaattcccaac
tcaacaaatgccaatctcaataatgccaatatgtccaaagctgcccatggcaagcggccc
agcattgcgaaccttgagcatgtgtctgacaatgggcatcattcctcccacaagcatgac
cgtgagcctcaaagaaggtccagttttaaaagaacccgctattatgaaacttacgttagg
tccgactctggagatgaacagctcccgactatttgctgggaagattcagagatacatggc
tacttccaggatccccgctgcttaggggagcaggagtatttcagcagtgaggaatactac
gaggatgacagctcgccgaccagaagcaggcataacaatggctactacaacagataccca
ggcagcagcttggacttcgaaaggccccgaggctaccaccacccccaaggcttcttagag
gacgatgactcacccgtttgctacgatcggagatctccaaggagacgcctactacctcca
accccaacatcccaccggagatcctccttcaactttgagtgcctgcggaggcagggcagc
caggaagaggtcccgccgtcgccggcttttccccaccgcacagcgctgcctctgcacctc
atgcagcaacagatcatggcagttgcaggcctagattcgagcaaagtccagaagtactca
ccgagtcactcgacccggtcatgggccacccccccagcgacgcccccctaccaggactgg
acgccctgctacacccccctgatccaggtagagcggtcagagtccctggaccaggtcaat
ggcagcctgccgtccctgcaccgcagttcctggtacacagatgaacctggtatcgcctat
cggactttcacgccagccagcctgactgtccccagcagcttccggaacaaaaacagcgac
aagcagaggagtgcggacagcttggtggaggcagtcctcatatctgaaggcttaggacgg
tatgcaagggacccgaaatttgtatcagcaacaaaacatgagattgccgatgcctgtgac
ctaaccattgacgagatggagagtgcagccagccacctgctcaacgggaacgtgagtccc
cgagccaatggggacgtgggccccgtctcacaccagcaggactatgagctacaagacttt
ggttctggctacagcgatgaagagccagaccctgggagatatgaggaggacctggcagat
gaaatgatatgcatcactaccttgtag

KEGG   Loxodonta africana (African savanna elephant): 100660460
Entry
100660460         CDS       T04351                                 

Gene name
CACNG8
Definition
(RefSeq) voltage-dependent calcium channel gamma-8 subunit
  KO
K04873  voltage-dependent calcium channel gamma-8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660460 (CACNG8)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100660460 (CACNG8)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100660460 (CACNG8)
   04261 Adrenergic signaling in cardiomyocytes
    100660460 (CACNG8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100660460 (CACNG8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100660460 (CACNG8)
   05414 Dilated cardiomyopathy
    100660460 (CACNG8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100660460 (CACNG8)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100660460 (CACNG8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100660460
NCBI-ProteinID: XP_023399863
LinkDB
Position
Unknown
AA seq 222 aa
MGSSQWEQKFARTVEVRVLVPPHPRRPLPIPAGPGGPPASACAVNPPKPPHGPAPRCPGW
WPTAPRLPVVKLESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRA
FICNTTNLTASDDGPPHRGPGGTSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPED
TDYDHDSAEYLLRTTQESRSSAPSSSFKDPILPYPDLSPSEP
NT seq 669 nt   +upstreamnt  +downstreamnt
atgggctcaagccaatgggagcagaaatttgctaggacggtggaggtgagggtcctggtg
ccacctcatcctcgccgccccctccccatccccgccggccccggggggcccccagcttct
gcctgcgctgtgaacccccccaagccgccgcacggccccgccccccgctgccccgggtgg
tggcccacggccccccggctgcctgtggtcaaactggagtcgctgaagcgctggaacgaa
gagcggggtctctggtgcgagaagggggtgcaggttctgctgacgacggtgggcgccttc
gccgcctttggcctcatgaccatcgctatcagcaccgactactggctgtacacgcgcgcc
ttcatctgcaacaccaccaacctcacagccagcgacgatgggcccccccaccgcgggcct
gggggcacctccgagaagaaggaccctggcggcctcacacactcaggcctctggagaatc
tgctgcctggaagggttgaaaagaggcgtctgcgtgaagatcaaccacttcccggaggac
acagactacgatcatgacagcgcggagtatctgctccgtacgacccaggagtcccggtcc
tcagccccctcctcctccttcaaggacccaattctcccctacccagacctttctccctca
gagccctag

KEGG   Loxodonta africana (African savanna elephant): 100663604
Entry
100663604         CDS       T04351                                 

Gene name
CACNA2D4
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-4
  KO
K04861  voltage-dependent calcium channel alpha-2/delta-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100663604 (CACNA2D4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100663604 (CACNA2D4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100663604 (CACNA2D4)
   04261 Adrenergic signaling in cardiomyocytes
    100663604 (CACNA2D4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100663604 (CACNA2D4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100663604 (CACNA2D4)
   05414 Dilated cardiomyopathy
    100663604 (CACNA2D4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100663604 (CACNA2D4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100663604 (CACNA2D4)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 VWA VWA_2 dCache_1 dCache_2 VWA_CoxE
Other DBs
NCBI-GeneID: 100663604
NCBI-ProteinID: XP_003410807
LinkDB
Position
Unknown
AA seq 1120 aa
MPGLPKFHPNPSSTHSVSPYPAWSVAWAFLQKTVVILWLLLACLPLPPTWAQTKIPLETV
KLWADTFGQDLYNTVTKYSGSLLLQKKYKDVESSLKIKEVDGLALVRKFSEDMENMLRSK
VEAVKRLVEAAEEADLNHEFNASLVFDYYNSVLINERDENGNFVELGAEFVLESNAHFSN
LMVNTSISSVQLPTNVYNKDPDILNGVFMSEALNTVFVENFQRDPTLTWQYFGSSTGFFR
IYPGIKWAPDENGVIAFDCRNRGWYIQAATSPKDIVIVVDVSGSMKGLRMAIAKHTISTI
LDTLGENDFVNIIAYNEYVHYIEPCFKGILVQADRDNREHFKQLVEELMVRGVGIVNQAL
SEAFQILKQFQEARQGSLCNQAIMLITDGAVEDYEPVFEKYNWPDRKVRVFTYLIGREVT
FADCMKWIACNNKGYYTQISTLADAQENVMEYLHVLSRPMVINHDHDITWTEAYLDSQLF
TSQAQSLMLLTTVAMPVFSKKNETRSHGILLGVVGSDVALRELMKLAPKYKLGVHGYAFL
NTNNGYILSHPDLRPLYREGKKLKPKPNYNSVDLSEVEWEDQAEILRTAMINGETGSLSM
NVKVPLDKGKRVLFLTNDYFFTDISDTPFSLGVVLSQGHGEYILLGNTSVEEGLHDLLHP
DVTVASEWIYCITDIDPDHRKLSQLEAMVNFLTGEDADLECDEELLQEVLFDAVVTAPME
AYWTGLALNMSEDSKDVDMAFLGTRAGLLRSGLFVGSEKVSNKKFLTPEDEASIFTMDHF
PLWYRQAAEQPAGSFVFNLHSAEAPESPGEAAVVTASTAVAMTVDKKTAIAAAVGVQIKL
EFLQRKFWAATQQCSGVDEPCPTSCQDNDLDCFVIDNNGFILISEQPQETGRFLGEVDGA
FMTQLLSMGVFNQVTMYDYQAMCKPPNHHHSAAQPLTSPIPAFLTATRWLLNELLLFLLE
WSAWGTWHADSGAEAKTVFHHSHKHKKQDMLQPCDTEYPVFVHQTAIQEANGIIDCGACQ
KMFVMQQIPKSNLLLLVTDSTCDCSIFPPVLQEATEVKYNASVKCDRMRSQKLRRRPDSC
HAFHPEENAQDCGGTSAISASLPLLLLPLCAWALLPQLLW
NT seq 3363 nt   +upstreamnt  +downstreamnt
atgcctggactccccaaatttcacccaaaccccagctccacccacagtgtgagcccctac
cctgcatggtcagtggcctgggccttcctacagaagactgtggtcatcctgtggctgctg
ctggcctgcctccccttgcctcccacttgggctcagaccaagattcctctggaaacagtg
aagctgtgggcagataccttcggccaggacctgtacaacactgtgaccaaatactcaggc
tccctcttgctgcagaagaaatacaaggatgtggagtccagtctgaagatcaaggaggtg
gacggcttggcactggtgaggaagttctcagaggacatggagaacatgctgcggagcaaa
gtggaggctgtcaagaggctggtggaggccgctgaggaggctgacctgaaccatgaattc
aacgcctctctggtgtttgactattacaactccgtgctgatcaacgagagggacgagaat
ggcaactttgtggagctgggagctgagtttgtcctggagtccaacgcacacttcagcaac
ctgatggtgaacacctccatcagcagtgtgcagctgcccaccaacgtgtacaacaaagac
cctgatattttaaacggagtcttcatgtctgaagccttgaacactgtttttgtggagaac
ttccagagagacccaacattgacctggcaatattttggcagctcaactggattcttcagg
atctatccaggtataaaatgggcacctgatgagaatggagtcattgcctttgactgccga
aatcgtggctggtacatacaggctgctacttctcccaaggacatagtgattgtagtggac
gtgagcggcagcatgaaggggctgaggatggctattgccaaacataccatctccaccatc
ttggacaccctgggagagaatgatttcgttaacatcattgcgtacaacgaatatgttcat
tacattgagccttgctttaaagggatcctcgtccaagcagatcgagacaaccgagagcat
ttcaaacagctggtggaagagctgatggtcagaggtgtagggattgtgaaccaagccctg
agtgaagccttccaaatcctcaagcagttccaggaggccaggcaaggaagcctctgtaac
caggccatcatgttgatcaccgatggtgccgtggaggactatgagccagtatttgagaag
tataattggccggatcgcaaggtccgagttttcacctacctcattgggagagaagtgact
tttgctgactgcatgaagtggatcgcgtgcaacaacaaaggctactatacgcagatctcc
acactggcagacgcccaggagaacgtgatggagtacctgcatgtgctcagccgccccatg
gtcatcaaccacgaccacgacatcacctggacagaagcttacctggacagccagctcttc
acctcgcaggcacagagcttgatgctcctgactactgtggccatgcctgtcttcagcaaa
aagaacgaaacgcgatctcatggcattctcctgggtgtggtgggctctgatgtagccctg
cgagagctgatgaagctggcacctaagtacaagctaggagtgcacggatatgcctttttg
aacactaacaatggctacatcctctcccatcctgacctccggcccttgtacagagagggg
aagaaactgaagcccaaacctaactacaacagcgtggatctctccgaagtggagtgggaa
gaccaagctgaaatcctgagaacagccatgatcaatggggaaactggctctctgtctatg
aacgtgaaggtgccactggacaaagggaagcgagtccttttcctgaccaatgattacttc
ttcacagacatcagtgacacacctttcagtttgggagtggtgctatcccagggccacgga
gaatacatcctcctggggaacacatcggtggaagaaggcctgcatgacctgcttcacccg
gatgtgaccgtagccagtgaatggatctactgcatcacagatatcgacccagaccaccgg
aagctcagccagctagaggccatggtcaacttcctgacaggggaggacgcagacctggaa
tgtgacgaggagctgctgcaggaggtgctgtttgacgcagtggtgacggctcccatggaa
gcctattggactgggctggctctcaacatgtctgaagactccaaggacgtggacatggcg
ttcctgggcacccgggctggtcttcttagaagcggcttgttcgtgggctccgagaaggtc
tctaacaagaagttcctgactcctgaagacgaggccagcatattcaccatggaccacttc
cctctgtggtaccgccaggctgctgagcagccagctggcagctttgtcttcaatcttcac
tcagcagaggcaccagaaagtccaggcgaggcagcagttgtaacggcaagcacagctgta
gccatgacagtggacaagaagacagccattgctgcagcagtgggcgtccaaataaagctg
gaattcctccaacgcaaattctgggcagcgacacaacagtgcagtggtgtggatgagccg
tgcccaacaagctgccaggacaatgacctggactgcttcgtcatagacaacaatgggttc
atcctgatctcagagcagccccaagagacaggaagatttctgggggaggtggatggtgct
tttatgacccaactgctcagcatgggggtgttcaaccaagtgaccatgtacgactaccag
gccatgtgcaagcccccgaatcaccaccacagtgcggcccagcccctgaccagcccaatc
cctgcattcctgactgctaccaggtggctgctgaatgagctcttgctgttcctgctggag
tggagtgcctggggcacctggcatgcggacagtggggccgaggccaaaactgttttccat
cactcccacaaacataagaaacaggatatgctgcagccctgcgacacggagtaccctgtg
tttgtgcaccagacagccatccaggaggccaacgggatcatcgattgtggggcctgccag
aagatgtttgtgatgcaacagattcccaagagtaacctcctcctcctggtgacagactcc
acgtgtgattgtagcatcttcccaccagtcctgcaggaggctacagaggtcaaatataat
gcctctgtcaagtgtgacaggatgcgctcccagaagctgcgccggcgaccagactcctgc
catgccttccacccagaggagaatgcccaggactgtggcggcacctcagccatctcagcc
tcgctccccctgctcctactgcctctgtgtgcctgggcactactgccccagcttctgtgg
tga

KEGG   Loxodonta africana (African savanna elephant): 100664775
Entry
100664775         CDS       T04351                                 

Gene name
CACNG4
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664775 (CACNG4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100664775 (CACNG4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100664775 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    100664775 (CACNG4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100664775 (CACNG4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100664775 (CACNG4)
   05414 Dilated cardiomyopathy
    100664775 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100664775 (CACNG4)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100664775 (CACNG4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 Patatin DUF2269
Other DBs
NCBI-GeneID: 100664775
NCBI-ProteinID: XP_003417258
LinkDB
Position
Unknown
AA seq 348 aa
MNTYSSPAASVPTSLPATAPELNTEQGLQCSRVLSHKLRWSCLHSTITTPRHRLHAEACL
PSLASAESALATFCPRRKGTPAAPLFHKCQNSHVRIYKGHCFRINHFPEDNDYDHDSSEY
LLRIVRASSVFPILSTILLLLGGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVY
ISSNTGDPSDKRDEDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKR
EFLKASSSSPYARMPSYRYRRRRSRSSSRSTEASPSRDTSPVGLKIAGAIPMGELSMYTL
TREPLKVTTAASYSPDQEASFLQVHDFLQQDLKEGFHISMLNRRTTPV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaacacctactcctctcctgctgccagtgtgcccacgtcactacctgccacagcacct
gaactaaacacagagcaggggctgcagtgctcccgggtgctgtcccacaagctccgctgg
agctgtctgcacagcaccatcaccaccccgaggcacaggctgcatgcggaagcctgcctg
cccagcctcgccagcgcggagagcgccttagccactttctgcccccgaagaaagggcacc
cctgctgcccctctattccacaagtgtcagaatagccacgtgcggatctataaagggcac
tgcttccggatcaatcacttccccgaggacaatgattacgaccatgacagctccgagtac
ctccttcgcatcgtgcgtgcctccagcgtcttccccatcctcagcaccatccttctcctg
cttggggggctctgcatcggcgccgggaggatctacagccgcaagaacaacatcgtcctc
agtgccggcatcctcttcgtggctgcaggcctcagcaacatcattggcattatcgtatac
atttccagcaacacaggtgacccaagtgacaagcgagatgaagacaagaaaaatcactac
aactacggctggtcattctactttggagccctgtcttttattgtggctgagaccgtgggc
gtcctggcagtgaacatttacattgagaaaaataaagagttgagatttaagaccaaacgg
gagttccttaaggcctcttcctcttctccttacgccaggatgccaagctacaggtaccgg
cgacggcgctcacgctccagctcacggtccactgaggcctcgccctccagggacacgtcg
cccgtgggcctgaagatcgcaggggccatccccatgggcgagctgtccatgtacacgctg
accagggagcccctcaaggtgaccactgctgccagctacagccccgaccaggaggccagc
ttcctgcaggtgcacgactttctccagcaggacctgaaggaaggtttccacatcagcatg
ctgaaccggcggacaacccccgtgtga

KEGG   Loxodonta africana (African savanna elephant): 100665821
Entry
100665821         CDS       T04351                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit isoform X2
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665821 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100665821 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100665821 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    100665821 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100665821 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100665821 (CACNG5)
   05414 Dilated cardiomyopathy
    100665821 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100665821 (CACNG5)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100665821 (CACNG5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 COPI_assoc DUF716 Serinc DHHC
Other DBs
NCBI-GeneID: 100665821
NCBI-ProteinID: XP_003417344
UniProt: G3UA92
LinkDB
Position
Unknown
AA seq 275 aa
MSGCGRKALTLLSSIFAVCSLGLLGIAVSTDYWLYLEEGVILPQNQSTEIKMSLHSGLWR
VCFLAGEERGRCFTIEYMMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtggctgcgggaggaaggccctgaccctgctgagcagcatctttgccgtgtgcagc
ctgggtctcctggggatcgctgtcagcactgactactggctgtacctggaggagggtgta
atcctgccgcagaaccagagcacagagatcaagatgtccctgcactccggcctctggcga
gtctgctttctggcaggtgaagagcggggccgctgcttcaccatagaatacatgatgccc
atgaacacccagctgacgtccgagtccacggtcaacgttctaaaaatgattcgctctgcc
acgccgttccctctggtcagccttttcttcatgttcattgggtttatcttgagcaatatt
ggacacatccgtccccacaggacaatactggcctttgtctctggcatcttctttatcctc
tcgggcctctctctcgtggtcggcctggtgctctacatctccagcatcaatgacgagatg
ctcaacaggaccaaggactcagagacctatttcaactacaaatacgggtggtcgtttgcc
ttcgctgccatctccttccttttaacagagagtgctggggtgatgtccgtgtacctgttc
atgaagcggtataccgccgaggacatgtacaggcctcaccccggcttctaccgcccgcgt
ctgagcaactgctccgattactcgggccagtttctacacccggacgcctgggtccggggc
cgcagcccctccgacatctccagcgacgcctccctacagatgaacagcaactatccagcc
ttgctcaagtgccccgactacgaccagatgtcatcttctccctgctga

KEGG   Loxodonta africana (African savanna elephant): 100666105
Entry
100666105         CDS       T04351                                 

Gene name
CACNG1
Definition
(RefSeq) voltage-dependent calcium channel gamma-1 subunit
  KO
K04866  voltage-dependent calcium channel gamma-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100666105 (CACNG1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100666105 (CACNG1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100666105 (CACNG1)
   04261 Adrenergic signaling in cardiomyocytes
    100666105 (CACNG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100666105 (CACNG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100666105 (CACNG1)
   05414 Dilated cardiomyopathy
    100666105 (CACNG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100666105 (CACNG1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100666105 (CACNG1)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin Clc-like UL45 LapA_dom DUF981 Claudin_3 DUF805 FA_desaturase
Other DBs
NCBI-GeneID: 100666105
NCBI-ProteinID: XP_003417345
UniProt: G3TL37
LinkDB
Position
Unknown
AA seq 224 aa
MSQTKTLKVRVTLFFILVGVVLAMVAVVTDHWAVLSPHLAHQNSTCEMAHFGLWRICTKR
IVLGDSKDKSCRTITLSGEKNCSYFRHFNPGETSEIFEVTTQKEYSISAAAIAIFSLGFI
IIGTIFLLFSFREKRDYLLRPASMFYAFAGLCIIVSVEVMRQSVKRMIDSEDTVWIEYYY
SWSFACACTAFVLLFLGGLTLLLFSLPPMPQNPWESCMDAEPEH
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcccagaccaaaaccctgaaggtccgtgtgaccctcttcttcatcctggtaggtgtt
gtgctggccatggtggctgtggtgaccgaccactgggccgtgctcagcccccatttggct
caccagaacagtacctgtgagatggcccacttcggcctctggcggatttgtaccaaacgc
atcgtgctgggtgacagcaaggacaagagctgcagaaccatcaccctgtccggggagaaa
aactgctcctacttcaggcattttaaccccggtgagacctcggagatcttcgaagtcacc
actcagaaagagtacagcatctcagcggctgccattgccatcttcagccttggtttcatc
atcataggcaccatcttcctcctcttttccttccgggagaagagggattacctgctgagg
ccggcatccatgttctacgccttcgcaggtctctgcatcattgtctcagtggaggtcatg
cggcagtcagtgaaacgcatgattgacagcgaggacaccgtctggatcgaatactattac
tcctggtccttcgcctgcgcctgcaccgcctttgtcctcctcttcctgggaggcctcact
cttctgctcttctccctgcctccaatgccccagaacccgtgggagtcctgcatggatgct
gagcctgagcattag

KEGG   Loxodonta africana (African savanna elephant): 100667110
Entry
100667110         CDS       T04351                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100667110 (CACNA2D2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100667110 (CACNA2D2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100667110 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    100667110 (CACNA2D2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100667110 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100667110 (CACNA2D2)
   05414 Dilated cardiomyopathy
    100667110 (CACNA2D2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100667110 (CACNA2D2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100667110 (CACNA2D2)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE DUF5610 Ntox50
Other DBs
NCBI-GeneID: 100667110
NCBI-ProteinID: XP_023403428
LinkDB
Position
Unknown
AA seq 1172 aa
MAVPARTCGASRPGPARTPHPWPGPGVQRPAPGTPRPLVLLLLSPLLLLPLLAAPGASAY
SFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGD
IESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIMYYDAKADTELDDPESEDMERGS
KASTLRLDFVEDPNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQD
PTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSV
SGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQG
MVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVR
VFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQ
VQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALSDIKRLTPNYT
LGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKG
HKQIRTLVKSLDERYIDEVMRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKY
FEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHN
LILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTENPEPFNSSF
YRRSLDNHGYVFKPPHQDTLLRPLELENDTVGVLVSTAVELSLGGRTLRPAVVGVKLDLE
AWAEKFKVLASNRTHQDQPQKQCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQW
DQVKVRKRVEGEGQGSNLLWVWHCQPVSTTPFRHPQVGRFFSEVDANLMLALYNNSFYAR
KESFDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSAAAWSLFQQFLYGLIYHSW
FQADPAEAEGSPEARESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLFHAQRLTHTNLLF
VVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGA
SFPPSLSVLVSLQLLLLLGLQPQVQAHASCRL
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctcccggcccggcccggcgcggaccccgcac
ccctggccaggccccggcgtccagcgcccggcgcccgggaccccgcgcccgctggtgctg
ctgctgctgtcgccgctgctgttgctaccgctgctcgccgcccccggtgcctctgcctac
agcttcccccagcagcacacgatgcagcattgggcccggcgcctggagcaggagatcgat
ggtgtaatgcggatttttgggggcgttcagcagctccgagagatctacaaggacaaccgg
aacctgtttgaggtgcaggagaatgaacctcagaagttggtggagaaggtggcgggagac
attgagagcctgctggacaggaaggtgcaggccctgaagagattggctgacgctgcggag
aacttccagaaagcccaccgctggcaggacaacatcaaggaggaagacatcatgtactat
gacgccaaggctgacactgagctggacgaccctgagagtgaggatatggagaggggatca
aaggccagcaccttgaggctggactttgtcgaggatccaaacttcaagaacaaggtcaac
tattcgtacacagcggtgcagatccctacggacatctacaaaggctccactgtcatcctc
aacgagctcaactggacggaggccctggaaaatgtcttcatcgagaaccgcaggcaggac
cccacactgctatggcaggtcttcggcagtgccacaggagtcacccgctactatccagcc
accccatggcgagcccccaagaagattgacctgtacgacgtccgaaggagaccctggtac
atccagggggcctcgtcacccaaggacatggtcatcatcgtggatgtgagcggcagcgtg
agcggcctgactctgaagctgatgaagacatctgtctgtgagatgctggatacactgtcc
gatgatgactatgtgaacgtggcctcgttcaacgagaaggcacagcctgtgtcatgcttc
acgcacctggtgcaggccaatgtgcgtaacaagaaggtgttcaaggaagctgtgcagggc
atggtggccaagggcaccacaggctacaaggccggctttgagtatgctttcgaccagctg
cagaattccaacattactcgtgccaactgcaacaagatgatcatgatgttcacggatggt
ggtgaggaccgagtgcaggacgtctttgagaagtacaactggcccaaccggacggtacgc
gtgttcacattttccgtggggcagcacaactatgatgtcacgcccctacagtggatggcc
tgtgccaacaaaggttactattttgagatcccttccatcggtgccatccgcatcaacacg
caggaatatctggacgtgttgggcaggcccatggtgctggcaggcaaagaggccaagcag
gtgcaatggaccaacgtgtatgaggatgcgctggggctaggattggtagtgacagggacc
ctccccgttttcaacctgacacaggatggccctggggaaaagaagaaccagctgatcctc
ggcgtgatgggcatcgatgtggctctaagtgacatcaagaggctgactcccaactataca
cttggagccaatggctacgtgtttgccattgacctgaacggctatgtgctgctacacccc
aacctcaagccccagaccactaacttccgggagcctgtgaccctggacttcctggatgca
gagctggaggatgagaacaaggaggagatccgtagaagcatgattgatggcaacaaaggc
cacaagcagatcagaacgctggtcaagtccctggatgagaggtacatagacgaggtgatg
cggaactacacctgggttcccataaggagcaccaactacagcctagggctggtgctcccg
ccatacagcaccttctacctccaagccaacctcagtgatcagatcctgcaggtcaagtat
tttgaattcctgctccccagcagctttgagtctgaaggacatgttttcattgctcccaga
gagtattgcaaggacctgaacgcctctgacaacaacaccgagttcctgaaaaacttcatt
gagctcatggagaaggtgactccagactccaagcagtgcaacaacttccttctgcacaac
ctgatcttggacacgggcatcacacaacagctggtggagcgtgtatggcgggaccaggac
ctcaacacgtacagcctgctggcagtgttcgctgccactgatggtggcatcacccgtgtc
ttccccaacaaggcagctgaggactggacagagaaccccgaacccttcaattccagcttc
taccgccgcagcctggataaccacggctatgtcttcaagcccccacaccaggataccctg
ttaaggccactggagctggagaacgacactgttggtgtcctggtcagcacagctgtggaa
ctcagcctgggagggcgcacactgaggccagcagtggtgggcgtcaagctggacctggag
gcctgggctgaaaagttcaaggtgctagccagcaatcgcactcaccaggaccaacctcag
aagcagtgcggccccagcagccactgtgagatggattgcgaagttaacaatgaggacctg
ctctgtgttctcattgatgatgggggattcctggtgctgtcgaaccagaaccatcagtgg
gaccaggtgaaagtcaggaaaagggtggaaggagagggacaaggctcaaaccttctgtgg
gtgtggcactgccagcctgtgtccacaacccccttccggcatccccaggtgggcaggttc
ttcagtgaagtggatgccaacctgatgctggcactctacaataattccttctacgcccgc
aaggagtccttcgactatcaggcagcctgtgcaccccagcccccagggaacctgggggct
gcgccgcggggcgtctttgtgcccaccattgcagacttccttaacctggcctggtggacc
tcggctgcggcctggtccttgttccagcagtttctctatggcctcatctaccacagctgg
ttccaggcagacccggcggaggccgaggggagccccgaggcgcgtgagagcagctgcgtc
atgaaacagacccagtactacttcggctcggtgaacgcctcctacaacgccatcatcgac
tgcggaaactgctccaggctgttccacgcgcagagactgacccacaccaaccttctcttc
gtggtggccgagaagccgctgtgcagccagtgtgaagctggccggctgctgcaaaaggag
acacactcggacggcccggagcagtgtgagctggtgcagagaccgcgataccggagaggc
ccacacatctgcttcgactacaacgcgacggaagatacctcagactgtggccgcggagcc
tccttcccgccgtcgctgagcgtcctggtctccctgcagctgctgctccttctgggcctg
cagccccaagttcaggcccacgcctcatgtcgcctttga

KEGG   Loxodonta africana (African savanna elephant): 100672020
Entry
100672020         CDS       T04351                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100672020 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100672020 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100672020 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    100672020 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100672020 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100672020 (CACNG7)
   05414 Dilated cardiomyopathy
    100672020 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100672020 (CACNG7)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100672020 (CACNG7)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Amastin L_HMGIC_fpl Claudin_3 Serinc DUF4064
Other DBs
NCBI-GeneID: 100672020
NCBI-ProteinID: XP_003406901
UniProt: G3U584
LinkDB
Position
Unknown
AA seq 275 aa
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKERAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtcactgtagcagccgcgccctgaccctgctgagcagtgtgtttggtgcctgcggc
ttgctccttgtgggcattgcggtcagcaccgactactggctatacatggaggagggtaca
gtgctgccacagaaccagaccaccgaggtcaagatggcactacacgctggcctctggaga
gtctgcttctttgcaggtcgtgagaagggtcgctgcgtggcctcggaatatttcctggaa
ccggagatcaatttggtgacggaaaacacggagaatattctgaagacagtgcgcacggct
acccccttccccatggtcagcctcttccttgtgttcactgccttcgtcatcagcaacatc
ggccacatccgcccacagaggaccattctggccttcgtttctggcatctttttcatcctg
tcgggcctctccttggtggtgggattggttctctacatctccagcatcaatgacgaggtt
atgaacaggcccagcagctctgagcagtattttcactatcgctacgggtggtcgtttgcc
ttcgctgcttcctccttcctactcaaagagagagccggcgtgatgtcagtgtacctgttc
accaagcgctacgcggaggaggagatgtaccgtccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagtttctgcagcctgaggcgtggcgccgcggc
cgcagcccctctgacatctccagcgacgtctccatccagatgacgcagaactaccctccc
gccatcaagtaccccgaccacctgcacatctccacctcgccctgctga

KEGG   Loxodonta africana (African savanna elephant): 100672366
Entry
100672366         CDS       T04351                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100672366 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100672366 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100672366 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    100672366 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100672366 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100672366 (CACNG3)
   05414 Dilated cardiomyopathy
    100672366 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100672366 (CACNG3)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100672366 (CACNG3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100672366
NCBI-ProteinID: XP_003418869
UniProt: G3TF52
LinkDB
Position
Unknown
AA seq 315 aa
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggtatccagatgttgatcactactgtgggagcctttgcagct
tttagtttaatgaccattgcagtgggcactgactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tccgggctgtggaggacctgctgcctagaaggggctttccgaggagtgtgcaagaaaatt
gatcacttccctgaagatgctgactacgaacaggatacagcagaatatttactgagggct
gtgagggcctccagtgtcttccccatcctcagcgtcacactgctgttctttggtgggcta
tgcgtggcagccagtgagttccatcgcagcaggcacaacgtcattctcagcgcgggcatc
ttttttgtctctgcagggttaagcaacatcatcggcatcattgtttatatatcagcaaat
gctggagaccccgggcagcgtgactccaaaaaaagctactcctatggctggtccttctat
tttggagccttctctttcatcatcgcggagattgtgggggtggtcgctgtacacatctac
attgaaaaacatcagcagttacgtgccaaatcccactcggagctcctgaagaaatctact
tttgcccgccttccaccctataggtatagattccggaggcggtcaagctcccgctccaca
gagcccagatcccgagacctgtcccccatcagcaaaggtttccacaccatcccttccacc
gacatctcaatgtttaccctctcccgggacccctcaaagatcaccatggggaccctcctc
aactccgaccgggaccatgcttttctacagttccacaactccactcccaaagagttcaaa
gagtcgctgcataataatccggccaacaggcgcaccacgcccgtctga

KEGG   Loxodonta africana (African savanna elephant): 100673089
Entry
100673089         CDS       T04351                                 

Gene name
CACNA1S
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04723  Retrograde endocannabinoid signaling
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673089 (CACNA1S)
   04020 Calcium signaling pathway
    100673089 (CACNA1S)
   04024 cAMP signaling pathway
    100673089 (CACNA1S)
   04022 cGMP-PKG signaling pathway
    100673089 (CACNA1S)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100673089 (CACNA1S)
   04929 GnRH secretion
    100673089 (CACNA1S)
   04912 GnRH signaling pathway
    100673089 (CACNA1S)
   04921 Oxytocin signaling pathway
    100673089 (CACNA1S)
   04935 Growth hormone synthesis, secretion and action
    100673089 (CACNA1S)
   04924 Renin secretion
    100673089 (CACNA1S)
   04925 Aldosterone synthesis and secretion
    100673089 (CACNA1S)
   04927 Cortisol synthesis and secretion
    100673089 (CACNA1S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100673089 (CACNA1S)
   04261 Adrenergic signaling in cardiomyocytes
    100673089 (CACNA1S)
   04270 Vascular smooth muscle contraction
    100673089 (CACNA1S)
  09156 Nervous system
   04727 GABAergic synapse
    100673089 (CACNA1S)
   04725 Cholinergic synapse
    100673089 (CACNA1S)
   04726 Serotonergic synapse
    100673089 (CACNA1S)
   04723 Retrograde endocannabinoid signaling
    100673089 (CACNA1S)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100673089 (CACNA1S)
   05020 Prion disease
    100673089 (CACNA1S)
   05022 Pathways of neurodegeneration - multiple diseases
    100673089 (CACNA1S)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100673089 (CACNA1S)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100673089 (CACNA1S)
   05414 Dilated cardiomyopathy
    100673089 (CACNA1S)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100673089 (CACNA1S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673089 (CACNA1S)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100673089 (CACNA1S)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 100673089
NCBI-ProteinID: XP_023404020
LinkDB
Position
Unknown
AA seq 1719 aa
MEPSSPQDEGLKKKQPKKPVPENLPRPPRALFCLTLENPLRKACISIVEWKLFEMIILLT
IFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQSNTTPLGSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFQAMLPLFHIALLVLFMLIIYAIIGLELFKGKMHKTCYFIGTDIMATVENE
KPSPCSRSGLGRRCTINGSECRGSWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFLTLILLGSFFILNLVLGILSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDVEDLREGKLSLVEGGSDTESLYEIEGLNKIIQFVRHWRRWNRI
LRWKCHDVVKSRVFYWLVILIVALNTLSIASEHHNQPLYLTYLQDVANRVLLALFTIEML
MKMYGLGLHQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSVRSIASLLLLLFLFITIFALLGMQLFGGRYDFEDVEVRRSNFDNF
PQAIISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVSIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSILAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWVTNFILLFILLSSAALAAEDPIRVKSVRNQILEYFDIVFT
SVFTVEIILKMTTFGVFLHKGSFCRNYFNILDLVVVAVSLISMGLESSTISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFIFACIGVQLFKGKFFSCNDL
SKMTEEECRGYYYVYKDGDPTQMELRPRQWIHNEFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNKEDMGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LNKNQRQCVQYALKARPLRCYIPKNPYQYKVWYFVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESGRISSAFFRLFRVLGVIKLVGGGEGVRTLLGTF
IKSFQGALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRC
ATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFVAV
IMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFC
PHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWK
RTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGL
RTIEEEAAPEIHRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLP
PVMANQRPLQFAEIEMEELESPVFLEDFPQHPSTNSLARANTNNANANTACGNSNHSNSH
VFSSVHYEREFPGEREVLAAREGALGQPHRAPGQSLLCT
NT seq 5160 nt   +upstreamnt  +downstreamnt
atggagccctcctcgccccaggatgagggcctgaagaagaaacagcccaagaagcctgtt
cctgagaatctgccaaggccaccccgtgccttgttctgcctgaccctagagaaccccctg
agaaaggcctgcatcagcatcgtggaatggaaactctttgagatgatcatcttgctcacc
atctttgccaactgtgtggccctggccgtgtacttgcccatgcctgaagatgacaacaac
tctctgaacctgggcctggagaagcttgagtatttcttcctcatcgtgttctcaattgaa
gctgccatgaagatcatcgcctatggcttcctattccaccaggatgcctacctgcgcagc
ggctggaacgtgctggacttcatcattgtcttcctgggggtcttcactgtgattctggag
caggttaacgtcatccaaagcaacacaacccctttgggcagcaaaggagctggcttggac
gtcaaggccctgagagccttccgtgtgctcagacccctccggctggtgtcgggggtgccc
agcctgcaggtggtcctcaactccatcttccaggccatgctccccctgttccacattgcc
ctgcttgttctcttcatgctcatcatctatgccatcattgggttggaacttttcaagggc
aagatgcacaagacctgctacttcattggaacagatatcatggccacagtagagaatgag
aagccctcgccctgctccaggtcgggcttggggcgccggtgtaccatcaacggcagcgag
tgccggggcagctggccaggacccaaccacggcatcacccacttcgacaactttggcttc
tccatgctcaccgtgtaccagtgcatcaccatggaggggtggaccgatgtgctttactgg
gtcaatgatgccatcgggaacgagtggccctggatctactttctcaccctcattctgctg
ggctccttcttcattctcaacctggtgctgggtattctaagtggggaattcaccaaggag
cgggagaaggccaaatccaggggaaccttccagaagctccgggagaagcagcagctggag
gaggaccttcgaggctacatgagctggattacgcagggcgaggtcatggacgtggaggat
ttaagagaagggaagctgtctttggttgaaggtggctccgacacagagagcctgtatgaa
attgagggcttgaacaaaatcatccagtttgtccgacactggaggcgctggaaccgcatc
ttacgctggaagtgccatgatgtggtgaagtccagggtcttctattggctggtgatcctg
atcgttgccctcaacaccctgtccatcgcctcagagcaccataaccagcccctatatttg
acctatttgcaagacgttgccaaccgggtgctactggctctcttcaccatcgagatgctg
atgaagatgtatgggctgggcttacaccagtacttcatgtccatcttcaaccgctttgac
tgcttcgtggtgtgcagcggcatcctagagatcctgctggtggagtcgggcgccatgaca
ccgctgggcatttctgtgcttcgctgcatccgcctcctgaggctgttcaagatcaccaag
tattggacatcactgagcaacctggtcgcatccctgctcaactccgtccgctccattgcc
tccctgctgctgctgctcttcctcttcatcaccatctttgctttgctgggcatgcagctc
tttgggggcaggtacgacttcgaggacgtggaggtgcggcgcagcaacttcgacaacttc
ccccaagccatcatcagcgtcttccaggtcctgacaggggaggactggacttcgatgatg
tacaacgggatcatggcctacggcgggccatcctaccccggcatgcttgtgtccatttat
ttcatcatccttttcgtctgtggcaactacatcttgctcaacgtcttcctggccattgct
gtggacaacctggccgaggcggagagcctgacttccgcccagaaggccaaggctgaggag
aagaaacgcaggaagatgtccaagggtctcccagacaagtcagaggaggagaagtcaatt
ttggccaagaagctggaacagaaacccaagggtgagggcatccccacaactgccaagctg
aaaatcgatgagtttgaatctaacgttaatgaggtgaaggacccttacccctcggctgac
ttcccaggggatgatgaggaagatgagcccgagatcccagtgagcccccgaccacgtccc
ctggctgagctgcagctgaaggagaaggcagtgcccattccagaagccagctccttcttc
atcttcagccccaccaataagatccgtgtcctgtgtcaccgcattgtcaacgccacctgg
gtcaccaacttcatcttgctcttcatcctgcttagcagtgctgccctggcggctgaggac
cccatccgggtgaaatctgtcaggaaccagatccttgagtattttgacatcgtgttcacc
tctgttttcactgtggagattatcctcaagatgacaaccttcggtgtcttcctgcacaag
ggctccttttgccggaactatttcaacatcctggacctggtggtagtggccgtgtccctc
atctccatgggacttgagtccagcaccatctctgtggtaaagatcctgagggtgctgagg
gtgctccgacccctccgagccatcaacagagccaaagggttgaagcacgtggtgcaatgt
gtgttcgtggccatccgcaccatcgggaacatcgtcctggtcaccaccctcctgcagttc
attttcgcctgcatcggcgtccagctcttcaagggaaagttcttcagctgcaatgactta
tccaagatgacagaagaggagtgcaggggctactactatgtgtacaaagatggggacccc
acgcagatggagctgcgtccccggcagtggatacacaacgaattccactttgacaacgtg
ctctcggccatgatgtcactcttcacagtctccaccttcgagggatggcctcagctactg
tacaaggccatagattcaaacaaggaggacatgggccccatctacaacaaccgagtggag
atggccatcttcttcatcatctacatcatcctcattgccttcttcatgatgaacatcttt
gtgggcttcgttattgtcaccttccaggagcagggggagactgagtacaagaattgtgag
ctgaacaagaaccagcgccagtgtgtacagtatgccctgaaagcccgcccactgaggtgc
tacatccccaaaaacccataccagtacaaggtgtggtacttcgtcacatcctcctacttc
gaatacctgatgtttgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aatcaatcagagcagatgaatcacatctcagatatcctcaacgtggccttcaccatcatc
ttcaccttggagatgatcctcaagctcatggcattcaaggccaggggctattttggagac
ccctggaatgtgtttgacttcttgatcgtcatcggcagcatcattgacgtcatccttagt
gagattgacactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
aacgttgacccagacgagagtggccgcatctccagcgccttcttccgcctgtttcgggtc
ttgggggtgatcaagctggtgggggggggagagggggtgcgcaccctgctggggaccttc
atcaagtccttccagggggccctgccttacgtggccctgctcattgttatgctcttcttc
atctacgctgtcatcggcatgcagatgttcgggaagatcgccatggtcgacgggacgcaa
ataaaccggaacaacaacttccagaccttcccacaagctgtattgcttctcttcaggtgt
gcaacaggagaggcctggcaggagatcctgctggcctgcagctacgggaagttgtgcgac
cccgagtcagactacgcccccggtgaggagtacacgtgtggcaccaacttcgcctattac
tacttcatcagcttctacatgctctgcgccttcctgatcatcaacctctttgtggctgtc
atcatggataactttgactacctcacacgggactggtccatcctgggccctcaccacctg
gatgaattcaaggcaatctgggcagagtacgacccggaggcaaaggggcgcatcaaacac
ctggacgtggtgaccctgctgagacggatccagccccctctgggctttgggaagttctgc
ccccaccgggtggcatgtaagcggctggtgggcatgaacatgcccctgaacagcgacgga
acggtcaccttcaacgccacgcttttcgcccttgtccgcacagcactcaagatcaagacg
gaaggtaactttgagcaggccaatgaggagctgagggccatcatcaagaagatctggaag
agaaccagcatgaagctcctggaccaagtcattcctccaataggagatgatgaggtgact
gtgggaaagttctatgccacgttccttatccaagagcacttccggaagttcatgaagcgc
caggaggagtattatgggtatcgaccaaagaaggacactgtacagatacaggctggactt
cgcaccattgaggaagaggcagcccctgagatccaccgcaccatctcaggagacctgaca
gctgaggaggagttggagagagccatggtggaggctgcgatggaggaggggatattccga
aggacaggaggcctgtttgggcaggtagacaacttcctggaaaggaccaactccctgccc
cctgtcatggccaaccagagacccctccagtttgctgagatagagatggaagaactggaa
tcacctgtcttcttggaggacttccctcaacatccaagtaccaactctcttgctcgtgcc
aataccaacaatgccaacgccaacactgcgtgcggcaacagcaaccatagcaacagccac
gtgttttccagcgttcactatgaaagggagttccctggagagagagaggtgcttgcagcc
agagaaggagccctcggacaaccccaccgggccccaggtcagtcccttctgtgcacctga

KEGG   Loxodonta africana (African savanna elephant): 100673091
Entry
100673091         CDS       T04351                                 

Gene name
CACNB2
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-2
  KO
K04863  voltage-dependent calcium channel beta-2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673091 (CACNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100673091 (CACNB2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100673091 (CACNB2)
   04261 Adrenergic signaling in cardiomyocytes
    100673091 (CACNB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100673091 (CACNB2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100673091 (CACNB2)
   05414 Dilated cardiomyopathy
    100673091 (CACNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673091 (CACNB2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100673091 (CACNB2)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Other DBs
NCBI-GeneID: 100673091
NCBI-ProteinID: XP_010589188
LinkDB
Position
Unknown
AA seq 654 aa
MVQSDMSKSPPTAAAAVAQEIQMELLDNAAPAGALGAAAQSYGKGARRKNRFKGSDGSTS
SDTTSNSFVRQGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVR
TNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLE
NMRLQHEQRAKQGKFYSSKSGGNSLSSLGDIVPSSRKSTPPSSAIDIDATGLDAEENDIP
ANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMM
QKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLGIEDFELAR
TLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAA
DKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLLSRTLATSTLP
ISPTRASNSQGSQGDHRTERSALARSTSQAEEEPCLEPVKKSQHRSSSSAQHHSHRSGTS
RGLSRQETFDSETQESRDSAYVEPKEDYSHEHSDHYAPHRDHNHRDEPHASSDHRHRESR
HRPRDIDREQDHNECNKQRSRHKSKDRYCDKDGEVISKKRNEAGEWNRDVYIRQ
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggtccaaagcgacatgtccaagtcgcctcccacagcggcggcggcggtggcgcaggag
atacagatggaactgctggataacgcagctcccgcgggggcgctcggagccgcggcacag
tcgtatggaaaaggagctagaaggaaaaacagatttaaaggctctgatggcagcacttca
tctgacactacctcaaatagcttcgttcggcagggttcggcagactcctacaccagccgt
ccatccgattccgatgtatctttggaggaagaccgggaggcagtgcggagagaagcagag
cgacaggcccaggcacagttggaaaaagcaaagacaaagcccgttgcatttgcagttcga
acaaacgtcagctacagtgcagcccacgaagatgacgttccagtgccaggcatggccatc
tcattcgaagcaaaagattttctgcatgttaaggaaaaatttaacaatgactggtggata
ggacgattggttaaagaaggttgtgaaatcggattcattccaagcccagtcaaactagaa
aacatgaggcttcagcatgaacagagagccaagcaagggaaattttactccagtaaatca
ggaggaaattcattatccagtttgggtgacatagtacctagttccagaaaatctacacct
ccatcatctgctatagacatagatgctactggcttagatgcagaagaaaatgatattcca
gcaaaccaccgctcccctaaacccagtgcaaacagtgtaacgtcaccccactccaaagag
aaaagaatgcccttctttaagaagacagagcacactcctccttatgacgtggtgccttct
atgcgaccggtggttctagtgggcccttccctgaaggggtatgaggtcacggatatgatg
caaaaagcattgtttgattttttaaaacacagatttgaagggcggatatccatcacaagg
gtcactgctgacatctcgcttgccaaacgctcagtattaaacaatccaagtaagcacgca
ataatagaaagatccaacacaaggtcaagcttaggaatcgaagattttgagcttgcaaga
acattacaactggtagtccttgatgcagacactattaatcacccagctcaactcagtaaa
acctctttggcccctattatagtatatgtgaagatttcttctcctaaggtgttacaaagg
ttaataaaatctcgagggaaatctcaagctaaacacctcaatgtccagatggtagcagct
gataaactggctcagtgtcctccagaattgtttgatgttatcttggatgagaaccagctc
gaggatgcctgtgagcaccttgccgactatctggaggcctactggaaggccacccatcct
cccagcagcaatctccccaatcctctccttagccgtactttagccacttcaactctgcct
attagccccacccgagcctctaattcacagggttctcaaggtgaccataggactgagcgg
tctgctcttgcccgttctacttcccaagctgaagaagagccctgcctggaaccagtcaag
aaatcccagcatcgttcttcctcctcagcccaacaccacagccatcgcagtggtacaagt
cgaggcctctccaggcaagagacttttgactcggaaactcaggagagtcgagactctgcc
tatgtagagcccaaggaagattattcgcacgaacactcggaccactatgccccacaccgc
gaccataaccaccgagatgagcctcacgcgagcagtgatcacagacacagggaatctcgg
caccgccccagggacatagatcgagagcaggaccacaacgagtgcaacaaacaaagaagc
cgtcataaatcaaaggatcgttattgtgacaaggatggagaagtaatatccaaaaaacgg
aacgaggctggggagtggaacagggatgtttacatccgccagtga

KEGG   Loxodonta africana (African savanna elephant): 100674649
Entry
100674649         CDS       T04351                                 

Gene name
CACNA1F
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04723  Retrograde endocannabinoid signaling
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100674649 (CACNA1F)
   04020 Calcium signaling pathway
    100674649 (CACNA1F)
   04024 cAMP signaling pathway
    100674649 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    100674649 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100674649 (CACNA1F)
   04929 GnRH secretion
    100674649 (CACNA1F)
   04912 GnRH signaling pathway
    100674649 (CACNA1F)
   04921 Oxytocin signaling pathway
    100674649 (CACNA1F)
   04935 Growth hormone synthesis, secretion and action
    100674649 (CACNA1F)
   04924 Renin secretion
    100674649 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    100674649 (CACNA1F)
   04927 Cortisol synthesis and secretion
    100674649 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100674649 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    100674649 (CACNA1F)
   04270 Vascular smooth muscle contraction
    100674649 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    100674649 (CACNA1F)
   04725 Cholinergic synapse
    100674649 (CACNA1F)
   04726 Serotonergic synapse
    100674649 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    100674649 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674649 (CACNA1F)
   05020 Prion disease
    100674649 (CACNA1F)
   05022 Pathways of neurodegeneration - multiple diseases
    100674649 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674649 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100674649 (CACNA1F)
   05414 Dilated cardiomyopathy
    100674649 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100674649 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100674649 (CACNA1F)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100674649 (CACNA1F)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100674649
NCBI-ProteinID: XP_023413606
LinkDB
Position
Unknown
AA seq 1743 aa
MSEAGTIAQYTCPSLTQFLHTDTTPEPCPANGTGTGQEWGLCPGPPAEGNEICGASGLGT
PRRRTQHSKHKMVAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCV
ALGVYIPFPEDDSNTANHILEQVEYVFWXFFTMETVLQIVAXGRCSIPALYIRNAPSSSL
LADVEAEDDPSPCASSGSGRACMLNQTECRGRWAGPNGGITNFDNFFFAMLTVFQCVTME
GWTDVLYWMQDAMGHELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQK
LREKQQLEEDLRGYLDWITKAEELDMEDPSTGGNSGSVAIMGQAGHRLPLAKLTNRRLGR
LRWFSHSTRSTHSTSSHGGGLARLGQRANEHATNSAPSHLCCRHWASLSNLVASLLNSMK
SIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWN
VVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGR
EKITEGNLPPENGALVPDGKNEEEEGARNEGAGKXAEPGGEGMEEEEEEEGVGGVEILQE
VVPKEKVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTNLILVFIILSSVSLAAEDPIR
AHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISF
GIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFA
CIGVQLFKGKFYSCTDEAKHTPQECKGSFLMYPDGDVSRPLVRERLWVNSDFNFDNVLSA
MMALFTVSTFEGWPALLYKAIDAHAEDKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGF
VIITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPYQYRVWATVNSAAFEYL
MFLLILLNTVALVMQHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFADAWN
TFDALIVVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGVRT
LLWTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLL
LFRCATGEAWQEIMLASLPGNRCDPESDFSPGEEFTCGSNFAIAYFISFFMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGF
GKLCPHRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRTVIK
KIWKRMKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLRTEAPPSTSS
VLQAGLRSLQDLGPEIRQALTCDTDEEKEEQGQKGEEEEDEKDPETYQAPIGSQPPSRRS
SMISVSLPVGDRLPDSLCLGPSDDYGRTSNSRQASMPQTGFHTCRRSSEPLIFTIPEEGS
SKPKGTKGQDKQDKKEEASNLLSYLDEQAETPPRLVLLPPHRPQRYVDGYHAPHRRLLPP
TPAGRKPSFTIQCLRRQGSCEDLPIPGTYHRERNSGPSRVQGSWATPPQQGRLLYAPLLL
VEEGAAGEGYLGKSSGPLRTFTCLHMPGTHLEPNHGKRSSADSLVEAVLISEGLDLFAQD
PHFVALAKQEIADACRLTLDEMDSTASDLLAQGASLLYSEEESILSSFDEEDLGDEMACI
HAL
NT seq 5232 nt   +upstreamnt  +downstreamnt
atgtcggaggcaggcacgattgcccaatacacttgtccctccctgactcagtttctccac
acagacactaccccagagccctgtccagctaatgggacagggactggtcaagaatggggc
ctgtgccctgggcccccagccgaagggaatgaaatctgcggggcatcaggtctgggcacc
cctaggcgaaggacccagcacagcaagcacaagatggtggcagtggccagtgcacagagg
tccccccgggccctcttctgcctcaccctggccaatccgctgcggagatcctgcatcagc
attgtggagtggaagcccttcgacatcctcatcctgctgaccatctttgccaactgcgtg
gccctgggggtctacatccccttccctgaggatgactccaacactgccaaccacatcctg
gagcaggtggagtatgttttttggtgatttttcactatggagactgtgctccagattgtg
gcctagggtaggtgctccatcccagcgctctatatccgcaatgccccgagctccagtctc
ctcgcagacgtggaggcagaagacgacccatcgccttgtgcgtcttcgggctccgggcgt
gcgtgcatgctgaaccagactgagtgccgcgggcgctgggcagggcccaacgggggcatc
accaacttcgacaacttcttcttcgccatgttaacggtcttccagtgcgtcaccatggaa
ggctggacagacgtgctctactggatgcaggatgccatggggcatgagctgccctgggtg
tacttcgtgagcctggtcatctttggatccttcttcgtcctcaaccttgtgctgggcgtc
ctcagtggggagttctccaaggagagggaaaaggcaaaagcacgaggggacttccaaaag
ctacgggagaagcagcagttggaggaggacctgcggggctacctagactggatcaccaag
gctgaggagctggacatggaggacccctctacaggcggcaactctggttctgtggctata
atgggccaggctggccaccggcttccacttgccaagctgaccaataggagacttggacgt
ctgcgctggttcagtcactccacccgctccacacactccaccagcagccatggtgggggt
ctagctaggctggggcagagggcgaatgaacatgcaaccaactctgccccctcccatctc
tgctgcagacactgggcatctctgagcaacctggtggcatccctgctcaattcaatgaaa
tccatcgcatccctgctgcttctcctcttcctctttatcatcatcttctctctgcttggc
atgcagctgttcggcggcaagttcaactttgaccagacccacaccaaacgaagcaccttt
gacaccttcccccaggccctcctcactgtctttcagattctgacgggcgaggactggaac
gtggtcatgtatgacggtatcatggcctacggcggtcccttcttcccagggatgctagtc
tgtatctatttcatcatcctcttcatctgcggcaactacatcttgctgaatgtgtttctt
gccattgctgtggacaacctggccagcggagatgcaggcactgccaaggacaagggcagg
gaaaagatcactgaggggaacctcccaccggagaatggggcgttggtacctgatgggaag
aacgaggaagaagaaggtgcaaggaatgaaggagcaggcaagtgagcagagccaggtgga
gaaggcatggaggaggaagaggaagaagaaggtgtggggggtgtggaaatcctgcaggaa
gttgtacccaaggagaaggtggtacccatccctgagggcagcgccttcttctgccttagc
caaaccaacccgctgaggaaggcctgccacaccctcatccaccatcatatcttcaccaat
cttatcctggtgttcatcatcctcagcagcgtctccctggccgctgaggaccccatccga
gcccactccttccgcaaccatattctggggtactttgactatgccttcacctccatcttc
actgtggagattctactaaagatgaccgtatttggggccttcttgcaccgtggctccttc
tgccgtagctggttcaatctgttggatctgctggtggtcagcgtatccctcatctccttt
ggcatccattccagtgccatctcagtggtgaagattctgcgagtactccgagtactgagg
cccctccgagccatcaacagggccaagggactcaagcatgtggtgcagtgtgtgttcgtg
gccattcggaccattgggaatatcatgattgtcaccacactcctgcaattcatgttcgcc
tgcattggcgtgcagctcttcaaggggaaattctacagctgcactgatgaggctaaacac
actccccaagaatgcaagggctccttcctgatgtaccccgatggagatgtgtcacggccc
ctggtccgggaacggctttgggtcaacagcgatttcaactttgacaatgtcctttcagcc
atgatggccctgttcactgtctccaccttcgaaggctggcctgcactactatacaaggcc
attgatgcacacgcagaagacaagggccccatctataattaccatgtggagatctctgtg
ttcttcattgtctacatcatcatcatcgcattcttcatgatgaacatttttgtgggcttt
gtcatcatcaccttccgtgcccagggagaacaggagtaccaaaactgtgagctagacaag
aaccagcgccagtgcgtggagtatgcactcaaggcccagccactccgccgctacatcccc
aagaacccatatcagtatcgcgtgtgggccactgtgaactctgctgccttcgagtacctc
atgttcctgctcatcctgctcaacacggttgccctagtcatgcagcactatgagcagact
gctcccttcaactatgccatggacatcctcaacatggtcttcactggcctcttcactgtt
gagatggtgctcaaaatcatcgccttcaaacccaagcattactttgctgatgcctggaac
acatttgatgctcttattgtggtgggcagcgtggtggacattgccgtcactgaagtcaat
aatggtggccaccttggtgagagctctgaggacagctcccgcatttccatcaccttcttc
cgtcttttccgagtcatgaggctggtcaagcttctcagtaagggtgaaggggtccgcaca
ttgctctggacattcatcaagtctttccaggccttgccctatgtggctcttctcattgca
atgatattcttcatctatgcagtcattggcatgcagatgtttggcaaggtggctcttcag
gatggcacgcagatcaaccgaaacaacaacttccagaccttcccacaggctgtgctgctt
ctgttcaggtgtgccactggtgaggcatggcaggagataatgctcgccagccttcctggg
aatcggtgtgaccctgagtctgacttcagccccggcgaggagtttacctgtggcagcaat
tttgctattgcctattttatcagtttcttcatgctctgtgcctttctgatcataaatctc
tttgtggctgtgatcatggacaactttgattatctaaccagagattggtccatcctgggc
ccccatcacctggatgaattcaagaggatctggtcggaatacgaccctggggccaagggc
cgcatcaagcacctggatgtggttgccctcctgagacgcatccagcccccactgggattc
gggaagctgtgcccacaccgtgtagcctgcaagaggcttgtggcgatgaacatgcccctc
aactcagatgggacagtgacattcaatgccacactctttgccctggttcggacgtccctg
aagatcaagacagaagggaacctggagcaagccaaccaggagctgcggactgtcattaaa
aagatttggaagcggatgaagcagaagcttctagatgaggtcatccccccaccagatgag
gaggaggtcaccgtgggcaaattctacgccacatttctgatccaggactacttccgcaaa
ttccggcggagaaaagaaaaggggctactacggactgaggcccccccaagtacctcctct
gttcttcaggctggtctgaggagcctacaagacttgggtcctgagatccggcaggccctc
acctgtgacacagatgaggagaaggaggaacaggggcagaagggagaggaggaagaagat
gagaaggatccagaaacctaccaagccccaataggctcccagcccccatctcgtcggagt
tccatgatttctgtgtctctgcctgttggggacagactccccgactcactctgtcttggg
cccagtgatgactatgggaggacttccaactccagacaggccagtatgccccagactgga
ttccacacctgcaggagaagctcagagcctctcattttcacaatcccagaagaaggaagt
tctaagcccaaaggaaccaaagggcaggacaagcaggacaagaaagaggaagcctctaac
ctgctctcctacctagatgagcaggcagagacacccccacgcctggtccttttgccacct
cacagaccccagagatatgtggatgggtaccacgccccccatcgccgtctgttgcccccc
acccctgcaggtaggaagccctcctttaccatccagtgtctgaggcgccaaggcagctgt
gaggatttacccatcccaggcacctatcatcgtgagcgaaattcagggcccagcagggtg
cagggttcctgggcaacccctcctcagcaaggtcggctcctatacgccccgctgttgttg
gtggaggagggtgcagcaggggaagggtaccttggcaaatccagtggtccacttcgtacc
ttcacctgtcttcacatgcctggaacccatttggagcccaaccatggcaagaggagcagt
gctgacagcctggtggaggctgtgctcatctctgagggactggacctctttgcccaagac
ccacactttgtggccctggccaagcaggagattgcggatgcatgtcgcctgacactggac
gagatggacagtaccgctagtgacttgctggcacagggggccagcttgctgtatagcgag
gaggagtccatcctctccagcttcgacgaggaggatctgggagacgagatggcctgcatc
cacgctctctga

KEGG   Loxodonta africana (African savanna elephant): 100676022
Entry
100676022         CDS       T04351                                 

Gene name
CACNA2D1
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-1
  KO
K04858  voltage-dependent calcium channel alpha-2/delta-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100676022 (CACNA2D1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100676022 (CACNA2D1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100676022 (CACNA2D1)
   04261 Adrenergic signaling in cardiomyocytes
    100676022 (CACNA2D1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676022 (CACNA2D1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100676022 (CACNA2D1)
   05414 Dilated cardiomyopathy
    100676022 (CACNA2D1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100676022 (CACNA2D1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100676022 (CACNA2D1)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 IFN-gamma
Other DBs
NCBI-GeneID: 100676022
NCBI-ProteinID: XP_023400241
LinkDB
Position
Unknown
AA seq 1045 aa
MQEDLVTLAKTASGVNQLVDIYEKYQDSYTVEPNNARQLVEIAARDIEKLLSNRSKALVR
LAGEAERVQAAHQWREDFASNEVVYYNAKDDLDPERNDSEPGSQRIKPVFIEDANFGRQI
SYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYP
ASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEM
LETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSF
AFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPI
QWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLV
ITGTLPVFNITGQDENKGNIKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNG
YVLLHPNLQPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDER
YIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKIEETITQARYSETLKPDNFEESGY
TFIAPRDYCSDLKISDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQN
YWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAP
YFNKSGPGAYESGIMVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPV
CDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSY
DYQSVCEPGAAPKQGAGHRSAYVPSIADILHIGWWATAAAWSILQQVLLSLTFPRLLEAV
EMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHVEKLMNTNLIFIMV
ESKGTCPCDTRLLIQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNNLEDYTDCGGVSGLN
PSLWSIIGIQCVLLWLVSGSRHCQL
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgcaagaagaccttgtcacactggcaaaaacagcaagtggagtcaatcagcttgttgat
atttatgaaaaataccaagattcgtatactgtggaaccaaataatgcacgtcagctggtg
gaaattgcagccagagatattgaaaaacttctaagcaacagatctaaggccctggtgcgc
ctggctggggaagcagagagagttcaagcagcccaccagtggagggaggattttgcaagc
aatgaagttgtctactacaatgcgaaagacgatcttgatcctgaaagaaatgacagcgag
ccaggcagccagaggataaaacctgtttttatcgaagatgctaattttggacgacaaata
tcttatcagcacgcagcagtccatattcccaccgacatctatgagggctcaacaattgtg
ttaaatgaactcaactggacaagtgccttagatgaagttttcaaaaaaaaccgagaggaa
gacccttcattgttgtggcaggtgtttggcagtgccacaggcctggccaggtattatcca
gcttcaccatgggttgataatagtaggactccaaataagattgacctttatgatgtacgc
agaagaccatggtacatccaaggagctgcatctcctaaagacatgcttattcttgttgac
gtgagtggaagtgttagtggactgactcttaaactgatccgaacctctgtctctgaaatg
ttggaaaccctctcggatgatgatttcgtgaatgtggcctcatttaacagcaatgcccaa
gatgtaagctgttttcaacaccttgttcaagcaaatgtaagaaataagaaagtgctgaaa
gatgcagtgaataacatcacagcaaaaggaatcacagattataaaaagggctttagtttt
gcttttgaacagctgcttaattataatgtttccagagcaaactgcaataaaatcatcatg
ttgttcacggatggtggagaagaaagagcccaggagatatttgccaaatacaacaaagat
aaaaaagtacgcgtattcacattttcagtcggtcaacataattatgacagaggacctatt
cagtggatggcttgtgaaaataaaggttattattatgaaatcccttccattggagctata
agaatcaatactcaggaatatttggatgttctgggaagaccaatggttttagcaggagac
aaagctaagcaagtccagtggacaaacgtgtatctggatgcattggaactgggtcttgtc
attactggaactcttccggtcttcaacataactggccaagatgaaaataagggaaacata
aagaaccagctgattcttggtgtgatgggagtagatgtgtctctggaggacattaaaagg
ctgacaccacgttttacactgtgccccaatggctattattttgcaattgatcctaatggt
tacgttttattacatccaaatcttcagccaaagaaccccaaatctcaggagccagtaaca
ctggatttccttgatgcagaattagagaatgatattaaagtggagattcgaaataaaatg
atagatggagaaagtggagagaaaacattcagaaccctggttaaatctcaagatgagaga
tacattgacaaaggaaatagaacatacacatggactcctgtcaatggcacagattacagt
ttggccttggtattaccaacctacagtttttactatataaaagccaaaatagaagagaca
ataactcaggccagatattcagaaaccctgaagccagataattttgaagaatctggctac
acgttcatagcaccaagagattactgcagtgaccttaaaatatcggataataacactgaa
tttcttttaaatttcaacgagttcattgatagaaaaactccaaataatccatcatgtaac
acggacttgattaatagaatcttgctggatgcaggctttacaaatgaacttgtccaaaat
tactggagtaagcagaaaaacatcaagggagtgaaagcgcgttttgttgtgactgatggt
gggattaccagagtgtatcccaaagaagctggagaaaattggcaagaaaacccagagaca
tatgaggacagcttttataaaagaagcctggataatgataactatgttttcactgctccc
tactttaacaaaagtggacctggtgcctatgaatcaggcattatggtaagcaaagctgta
gaaatatatatacaaggaaaacttcttaaacctgcagttgttggaattaaaattgatgta
aattcctggatagagaattttaccaaaacttcaatcagggatccgtgtgctggtccagtt
tgcgactgcaaaagaaacagtgatgtaatggattgtgtgattctagatgatggtggcttt
ctattgatggcaaatcatgatgactatactaaccagattggaagattttttggagagatt
gatccgagcttgatgagacaccttgttaatatatcagtttatgcttttaacaaatcttac
gattatcagtcggtgtgtgagcccggtgctgcaccaaaacaaggagcagggcatcgctca
gcatatgtgccatccatagcagacatattgcacattggctggtgggctactgctgctgcc
tggtctattctacagcaggttctcttaagtttgacttttccacgactcctagaggcagtt
gagatggaagatgatgacttcacagcttccctgtcaaagcagagctgcattactgaacaa
acccagtatttctttgataatgatagtaaatcattcagtggtgtattagactgtggaaat
tgttccagaatctttcatgtagaaaagcttatgaacactaacttaatattcataatggtt
gagagcaaggggacatgtccctgtgacacacgactgctcatacaagcggagcagacttct
gatggtccagatccttgtgatatggttaagcaacccagataccgaaaagggcctgatgtc
tgctttgataacaataacctggaggattatactgactgtggtggcgtttctggattaaat
ccctccctgtggtctatcatcggaatacagtgtgtactgctttggctggtatctggcagc
agacactgccagttatga

KEGG   Loxodonta africana (African savanna elephant): 104846285
Entry
104846285         CDS       T04351                                 

Gene name
CACNB1
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit beta-1 isoform X1
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104846285 (CACNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104846285 (CACNB1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104846285 (CACNB1)
   04261 Adrenergic signaling in cardiomyocytes
    104846285 (CACNB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104846285 (CACNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104846285 (CACNB1)
   05414 Dilated cardiomyopathy
    104846285 (CACNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    104846285 (CACNB1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104846285 (CACNB1)
SSDB
Motif
Pfam: Guanylate_kin
Other DBs
NCBI-GeneID: 104846285
NCBI-ProteinID: XP_023409404
LinkDB
Position
Unknown
AA seq 553 aa
MFQCLPLHPSRVKGSCSFFALFGLPTGCGGHVGVCWLQSKTVKGIIKLGRLACTVAEVGA
KLGSSLSQFFSKTQKRGRACLSLPKSTGLLVLLPAPIQGCLWLPLGMGSRPLFLALSVTN
THALLSLLVCPLSLSCPGSFLALCPCLGTLPSPLPFLSWQSLDPAKQKQKSTEHVPPYDV
VPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPS
KHIIIERSNTRSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIK
ITSPKVLQRLIKSRGKSQSRHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYL
EAYWKATHPPSSTPPNPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHVSV
HEYPGELGQPPGLYSSSHPPGRAGTLRALPRQDTFDADTPGSRNSAYTELGDSCVDMETD
PSEGPGLGDPAGGSTPPARQGSWEDEEDDYEEELTDNRNRGRNKARYCAEGGGPVLGRNK
NELEGWGRGVYIR
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgttccagtgtttgcccctgcacccctcccgtgtaaagggaagttgctccttctttgcc
ctttttggactcccaacgggctgtggtggacatgtgggggtctgctggctgcagagcaag
acagtcaagggaatcattaaattgggcaggttggcatgcactgtagcagaagtgggcgcc
aaattagggtcgtcactctcccagttcttttccaagacccagaagaggggtagggcatgt
ctaagtcttcccaagtccactggactgttagtcctgctcccagccccaatccagggctgt
ctctggctcccccttggcatggggtcccgtcccctctttctggctctgtctgtcactaac
acgcatgccctgttatctctcctcgtctgcccgctttccctctcttgtcctggctccttc
cttgccctctgcccctgcctgggtaccctcccctctcccctcccctttctctcttggcaa
tctctggacccagccaaacagaagcagaagtcgacagagcatgtgcccccctatgacgtg
gtaccttccatgagacccatcatcctggtgggaccgtcgctcaagggttatgaggttaca
gacatgatgcagaaagctttatttgacttcttgaagcatcgttttgatggcaggatctcc
atcactcgtgtgacagcagacatttctctggctaagcgctcagtcctcaacaaccccagc
aagcacatcatcattgagcgctctaacacacgttccagtctggctgaggtgcagagtgag
attgagcgaatcttcgagctggcccggacccttcagttagtggccctggacgccgacacc
atcaaccacccagcccagctctccaagacctcactggcccccatcattgtttacatcaag
atcacctctcccaaggtacttcagaggctcatcaagtcccgagggaagtctcagtccaga
cacctcaatgtccaaatagcagcctcggagaagctggcacaatgtccccccgaaatgttt
gacatcatcctggacgagaatcaattggaggatgcctgcgagcacctggccgaatacttg
gaagcctattggaaggccactcacccgcccagcagcactcctcccaatccgctgctgaac
cgcacaatggctaccgcagccctggctgccagcccagcccccgtctccaacctccaggga
ccctaccttgcttccggggaccagccactggaacgggccaccggggagcacgtcagtgtg
cacgagtacccgggggagctgggccagcccccaggcctttactccagcagccacccacca
ggccgggcgggcaccctgcgggcactaccccgccaagacacgtttgatgctgacacccct
ggcagccgaaactctgcctacacggagctgggagactcgtgtgtggacatggagactgac
ccctcggaggggccggggcttggagaccctgcagggggcagcaccccaccagcccggcag
ggctcctgggaagatgaggaagacgactatgaggaagagctgactgacaaccggaaccgg
ggccggaataaggcccgctactgcgctgagggtgggggtccagttctggggcgcaacaag
aatgagctggagggctgggggcgaggtgtctacatccgctga

KEGG   Loxodonta africana (African savanna elephant): 111749631
Entry
111749631         CDS       T04351                                 

Gene name
CACNG6
Definition
(RefSeq) voltage-dependent calcium channel gamma-6 subunit
  KO
K04871  voltage-dependent calcium channel gamma-6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04921  Oxytocin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111749631 (CACNG6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    111749631 (CACNG6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111749631 (CACNG6)
   04261 Adrenergic signaling in cardiomyocytes
    111749631 (CACNG6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    111749631 (CACNG6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    111749631 (CACNG6)
   05414 Dilated cardiomyopathy
    111749631 (CACNG6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    111749631 (CACNG6)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111749631 (CACNG6)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin Phage_holin_3_6 DUF1700
Other DBs
NCBI-GeneID: 111749631
NCBI-ProteinID: XP_023399945
LinkDB
Position
Unknown
AA seq 167 aa
MRDHHVIASLSFSPAPTEANCTYFKFFTTGQNAHIFQRTTKKEVNLAAAVIAVLGLTIMA
LGYLCIIMVLSKGAEFLLRVGAICFGLSGLLLLVSVEVFRHSVQALLERVSSDPPPAPAL
AYEYSWSLDCGVAAGLILMLGGGCFLLLTLPSWPWGGLCPKQGRRGT
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagggatcaccatgtcatcgcctccctttctttctctcctgctcccacagaagcaaac
tgcacctactttaaattctttacaacgggccagaatgcacacatcttccagagaaccaca
aagaaagaggttaatctggcagctgcagtgatagcagtgctgggcctgacaatcatggcc
ctggggtacctctgtatcatcatggtgctcagcaaaggtgcagagttcctgctccgagtt
ggagccatctgttttggcctctcaggcctcctacttctggtgagcgtggaggtgttccgg
cattccgtgcaagccctgctcgagagagtcagctctgaccctccgccggccccggccctg
gcctacgaatactcctggtctctggactgcggagtggcagccggcctgatcctgatgttg
gggggcggctgcttcctgctgctcaccctgccttcctggccctgggggggcctctgtccc
aagcaggggcgcaggggcacctag

DBGET integrated database retrieval system