KEGG   Loxodonta africana (African savanna elephant): 100654018
Entry
100654018         CDS       T04351                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis-inducing factor 2 isoform X1
  KO
K22745  apoptosis-inducing factor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100654018 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA NAD_binding_8 K_oxygenase DAO Thi4 Trp_halogenase HI0933_like Lycopene_cycl AlaDh_PNT_C FAD_binding_2 FAD_oxidored FAD_binding_3 Peptidase_S28 Malic_M
Other DBs
NCBI-GeneID: 100654018
NCBI-ProteinID: XP_010587498
LinkDB
Position
Unknown
AA seq 394 aa
MGSQVSVDVGSMHVVIVGGGFGGMAAASQLQAMNVPFTLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKDNFRQGVVVGIDLKNQTVQLQGGEALPFSHLILATGSTGPFPGKFN
QVSSQQAAIQAYEDIVRQVQSSQVIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPCVRQEVKEILLRKGVQLLLSRCHFVSLPAPLPGLLRFGSTGERVSNLEELPVNE
YREYIKVQTDKGTEVATNLVIPCNGIKVNSSAYCSAFESRLASNGALQVNEYLQVEGYSN
VYAIGDCADVKEPKMAYHAGLHANIVTTNIINSMKQRPLKAYKPGALTFLLSMGRNDGVG
QISGFYVGWLMVQLLKSRDLFVSTSWKTMKQSPP
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggggtcccaggtctcagtggatgtgggatcaatgcacgtggtgatcgtgggtgggggc
ttcggcgggatggcggccgccagtcagctccaagcaatgaacgtccctttcacgcttgtg
gacatgaaagactccttccaccacaacgtggcagccctccgggcctccgtggagagtggg
tttgccaaaaagacattcatttcctactcagtgaccttcaaggacaacttccgacagggc
gtggtggtcgggatagacctgaagaatcagacggtgcagctgcaaggcggtgaggcactg
cccttctcacatctcatcctggccacaggcagcactgggccctttcctggcaagtttaac
caggtttccagccaacaggctgccatccaggcctatgaggacatagtgaggcaggtccag
agctcacaggtcatcgtggtggtgggaggaggctcagcgggagtagagatggcagcagag
attaaaacagagtatcctgagaaagaggtcactctcattcactcccaagtagcccttgct
gacaaagagctcctgccttgtgtccggcaggaagtgaaggagatccttctccggaaaggc
gtgcagctgctgctgagtaggtgccactttgtctccctccctgcccctctccctggcctg
ctgagatttggctccacaggcgagcgagtgagcaacctggaagaactgcctgtcaacgag
tatcgagagtacataaaagtgcagacagacaaaggcacggaggtggccaccaacctggtg
atcccctgcaacgggatcaaggtcaacagctccgcctactgcagtgcatttgagagcaga
ctcgccagcaatggtgcccttcaagttaacgagtacctccaggtggaaggctacagcaat
gtctacgccatcggtgactgtgctgacgtgaaggagcccaagatggcctatcacgctggc
ctccatgccaacattgtcacgaccaacatcatcaactccatgaaacagaggcccctcaag
gcctacaagcctggtgcactgacattcctcctgtccatggggagaaatgatggcgtgggc
cagatcagtggcttctacgtgggttggctcatggttcaactgctcaagagtcgggacctg
ttcgtctccacgagctggaaaaccatgaagcagtctccaccctga

DBGET integrated database retrieval system