KEGG   Loxodonta africana (African savanna elephant): 100654083
Entry
100654083         CDS       T04351                                 

Gene name
TICAM1
Definition
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04217  Necroptosis
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav05133  Pertussis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100654083 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100654083 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100654083 (TICAM1)
   04621 NOD-like receptor signaling pathway
    100654083 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100654083 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100654083 (TICAM1)
   05133 Pertussis
    100654083 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100654083 (TICAM1)
   05160 Hepatitis C
    100654083 (TICAM1)
   05164 Influenza A
    100654083 (TICAM1)
   05168 Herpes simplex virus 1 infection
    100654083 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100654083 (TICAM1)
   05165 Human papillomavirus infection
    100654083 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100654083 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 100654083
NCBI-ProteinID: XP_003421709
UniProt: G3UHM6
LinkDB
Position
Unknown
AA seq 700 aa
MADTEPSLPGAFDILRGAGQDKLLHLKHKLKTLHLSCQGASLLRAMVLLALGQDTEARLS
LEMLRTDAAAQFVARRWASMDITEALEEPKDMSWTVACVYHLLAEEKLCPASLREAAYRA
ALQALSSMDDPRLPELQAEARDRCGWDVSNSGGFQPLHSHLGGRPPSSALRSEIRSVPQP
IRNPSGWSQACSLKSTDSPASLASNLEISQSPTMLFLTQPHSPPRPSKLCDEPRDSLRPE
PTPMGCQEPEQVNWPPSMETDPPQEPPHSPAPQLPVVAPDPSPAGLPNPSTPLASRAHYP
EECTEVSVAPQSLPSTPQSLPSPVLDPPDNPTKNGTSVPLSVEDTASQKSKQSPPPPSAP
QTSSPSHSASASPACAAPPASSSGPAPPELESSEQKFYNFVVLHARADEHVALRVRERLE
QLGVPDGATFCEDFRVPGRGELSCLQDAIDHSAFTILLLTPNFDCRLSLHQVTQALMSSF
VRHGWQDSVIPFQPLETSELSSDATRLLSSLVCLNEHSQLFERKVKNTFKRQKLQERKAT
WKKEQQVRAVREYSQHLEGERQHAAEMSTAYSAYLQSYLAFQAQMERLQVALGTQMSLGP
QMPPGVQMPFAGQVPQGVQLPLPTWPGYPQPPLPPWLASTPPPAFPQPPSFLPVSPGSPQ
SPGLQPLIIHHAQMVQLGLNNHMWGQREAQAPEDKSQEAE
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggccgacacagaaccctcgctccctggagcatttgacattctccgtggggcgggccag
gacaagctcttgcatctgaagcacaaactaaagacactgcatctgagctgccagggggcc
agcctactgcgtgccatggtgctcctggcgttgggccaggacactgaggcccgactctcc
ctggagatgctgaggacagatgcagcagcccagtttgtggcccgccggtgggccagcatg
gacatcactgaggccctagaggagccaaaggacatgtcctggacagttgcctgtgtgtac
cacttgctggctgaggagaagctgtgcccggcgtcactgcgggaggccgcctaccgagct
gccctccaggccctcagctccatggacgacccccggctgccagagctccaggcagaggcc
cgtgaccggtgcgggtgggacgtcagcaactcgggtggcttccagcccctgcactcccat
ctgggcggccgcccaccatcctcggcattgcgctcagagataaggagcgtacctcagccc
atcaggaatccctcaggctggagccaggcgtgttccctgaagtccacggacagcccagcc
tctctggccagcaacctggagatcagccagtcacccaccatgcttttcctcacccagccc
cacagcccccccaggcccagcaagctctgtgatgagccccgggacagccttaggcccgag
cctacccccatgggctgccaggagccggagcaggtgaactggcccccctccatggagact
gacccccctcaggagcccccacacagtccagccccccagctgcctgtggtggccccagat
ccaagccctgctggccttcccaacccctcaacaccgctggcatccagagcccactatcca
gaggagtgtactgaggtgtctgtggccccccagtctctcccctcaaccccccagtctctc
ccctcacctgtcctagaccccccggacaaccctaccaaaaatgggacatcagtcccactt
tctgtagaagacactgcctcccagaaatctaagcagagcccgcctcctccctcagccccc
caaacgtcctctccctcacactctgcttctgcatcaccggcgtgtgcggctcccccggcc
tcgtcctcaggccccgcgccccccgagttggagtcctccgagcaaaagttctataacttt
gtggtcctccatgccagggccgatgagcacgtggctctgcgtgtccgtgagaggctggag
cagctgggcgtcccggacggggccaccttctgcgaggacttccgggtgcccgggcgcggc
gagctgagctgcctgcaagatgccatcgaccactctgccttcaccattctgctgctcact
cccaacttcgactgccgcctgagcctgcaccaggtgacccaggccctgatgagcagcttc
gtgaggcacggctggcaggactccgtcatccccttccagccgttggagacatccgagctc
agctccgacgcaaccaggctgctctccagccttgtgtgcttgaacgaacactcccagctc
tttgaaaggaaggtgaaaaacaccttcaagaggcagaaactgcaggagcgcaaggccacc
tggaaaaaggagcagcaggtccgggcggtccgggaatacagccagcacctggagggtgag
cgacagcacgcggccgagatgagtaccgcctactctgcctacctgcagagctacctggcc
tttcaggcgcagatggagaggctacaggtggctttgggaacccagatgtcgctcgggcct
caaatgccccccggggttcagatgccctttgcggggcaagtgccccagggggttcagctg
cccttgcctacctggccaggctaccctcagccacccctgcctccatggctggctagcact
cctccaccagccttcccgcagcccccctccttcctaccagtttcccctgggtcccctcag
agccctgggctgcagcccctcattatccaccacgcgcagatggtccagctggggctcaac
aaccatatgtggggccaaagggaggcccaggcccctgaggacaaatcacaagaagcagaa
tga

DBGET integrated database retrieval system