KEGG   Loxodonta africana (African savanna elephant): 100654098
Entry
100654098         CDS       T04351                                 

Gene name
ARHGDIB
Definition
(RefSeq) rho GDP-dissociation inhibitor 2
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04722  Neurotrophin signaling pathway
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100654098 (ARHGDIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100654098 (ARHGDIB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100654098 (ARHGDIB)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100654098 (ARHGDIB)
  Exosomal proteins of other body fluids (saliva and urine)
   100654098 (ARHGDIB)
  Exosomal proteins of colorectal cancer cells
   100654098 (ARHGDIB)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 100654098
NCBI-ProteinID: XP_003405720
LinkDB
Position
Unknown
AA seq 200 aa
MTEKDPEAHLEEDVDELDSKLNYKPPPQKSLKELQEMDKDDESLAKYKKTLLGDGPVVAD
PAAPNVTVTRLTLVCDSAPEPITMDLTGDLEALKKENFVLKEGVEYKVKIHFKVNKDIVS
GLKYVQHTYRSGMKVDKASFMVGSYGPRPEEYEFLTPTEEAPKGLLARGTYHTKSFFTDD
DKHNHLTWEWNLSIKKDWTE
NT seq 603 nt   +upstreamnt  +downstreamnt
atgactgaaaaggacccagaagcacacctggaggaagatgttgatgagctggacagcaag
ctcaattacaagcccccacctcagaagtccctgaaagagctacaagagatggacaaagat
gacgaaagtctagccaagtacaagaaaacactcctgggggatggtcctgtggtagcagac
ccagcagcccccaatgttacggtcacccggctaaccctggtgtgtgatagtgccccagaa
ccaatcaccatggacctcaccggggatcttgaagccctcaaaaaagaaaactttgtgcta
aaagaaggcgttgaatataaagtcaaaattcacttcaaagtgaacaaggatattgtgtca
ggcctgaaatatgttcagcacacctaccggagtgggatgaaagtggataaggcatcattt
atggttggcagctacgggcctcgacctgaggagtatgagttcctgactcccacagaggag
gctccaaagggcctgctggcccggggtacttaccacaccaagtccttcttcaccgatgat
gacaagcacaaccaccttacctgggagtggaacctgtccattaagaaggactggacagaa
tga

KEGG   Loxodonta africana (African savanna elephant): 100676447
Entry
100676447         CDS       T04351                                 

Gene name
ARHGDIA
Definition
(RefSeq) rho GDP-dissociation inhibitor 1
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04722  Neurotrophin signaling pathway
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100676447 (ARHGDIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100676447 (ARHGDIA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676447 (ARHGDIA)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100676447 (ARHGDIA)
  Exosomal proteins of other body fluids (saliva and urine)
   100676447 (ARHGDIA)
  Exosomal proteins of colorectal cancer cells
   100676447 (ARHGDIA)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 100676447
NCBI-ProteinID: XP_003417377
LinkDB
Position
Unknown
AA seq 204 aa
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVIVTRLTLVCSTAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGIKIDKTDYMVGSYGPRAEEYEFLTPMEEAPKGMLARGSYTVKSH
FTDDDKTDHLSWEWNLTIKKDWKD
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctgagcaggagcccaccgctgagcagctggcacagattgcagctgagaatgaggag
gatgagcactcggttaactacaagccaccggcccagaagagcatccaggagatccaggag
ctggacaaggacgatgagagtctgcgcaagtacaaggaggccctgctgggccgcgtggcc
gtgtctgccgaccccaacgtccccaatgtcatcgtgacacggctgaccctggtgtgcagc
accgccccaggccccctggaactggacctgacaggagacctggagagcttcaagaagcag
tcgttcgtacttaaggaaggcgtggaataccggataaaaatctctttccgggtgaacaga
gaaatcgtgtctggcatgaagtacatccagcacacctacaggaaaggcattaagattgac
aagaccgactacatggtgggcagctacgggccacgggcagaggagtatgagtttctgacc
cccatggaggaggcacccaagggcatgctggcacggggcagctacactgtcaagtcccac
ttcacggatgatgacaagacagaccacctgtcttgggagtggaacctcaccatcaaaaag
gactggaaggactga

KEGG   Loxodonta africana (African savanna elephant): 100677099
Entry
100677099         CDS       T04351                                 

Gene name
ARHGDIG
Definition
(RefSeq) rho GDP-dissociation inhibitor 3
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04722  Neurotrophin signaling pathway
lav04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100677099 (ARHGDIG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100677099 (ARHGDIG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100677099 (ARHGDIG)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100677099 (ARHGDIG)
  Exosomal proteins of other body fluids (saliva and urine)
   100677099 (ARHGDIG)
  Exosomal proteins of colorectal cancer cells
   100677099 (ARHGDIG)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 100677099
NCBI-ProteinID: XP_003417754
LinkDB
Position
Unknown
AA seq 166 aa
MMGVDDCELGEHLIELLRLELCSRVLMTDKDGGPLPPDEALDDTMVAYRAPRQKSLRELQ
ELDLDDESLTKYKQALLGPLPPVSDPCVPNVQVMRLTLMSEQAPGPITMDLSGDLVVLKN
QVFVLKEGVDYRVKITFKFVTPVEEAPQVAGTGAYVVLSCFTDDDR
NT seq 501 nt   +upstreamnt  +downstreamnt
atgatgggcgtggacgactgcgaactgggggagcatctcatagagctgctcaggttggag
ctgtgctcccgagtcctcatgacggataaggatggtgggccactgccaccagatgaggcg
ctggacgacaccatggtggcgtaccgggccccaaggcagaagagcctgcgagagctccaa
gagctagacttggacgatgaaagcctgaccaagtacaagcaggcgctgctggggcccctg
ccaccggtctcggacccgtgcgtgcccaacgtgcaggtgatgcggctgacgctgatgtcc
gagcaggccccagggcccataaccatggacctctcaggggacctggttgtgctgaagaac
caggtgtttgtcctgaaggagggtgtggattacagagtgaagatcaccttcaagttcgtg
actccggtggaggaggcgccgcaggtggctggcacgggcgcctacgtggtcttgtcctgc
ttcacggacgacgaccggtga

DBGET integrated database retrieval system