KEGG   Loxodonta africana (African savanna elephant): 100654118
Entry
100654118         CDS       T04351                                 

Gene name
EDNRB
Definition
(RefSeq) endothelin receptor type B isoform X1
  KO
K04198  endothelin receptor type B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04916  Melanogenesis
lav04926  Relaxin signaling pathway
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100654118 (EDNRB)
   04022 cGMP-PKG signaling pathway
    100654118 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100654118 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100654118 (EDNRB)
   04916 Melanogenesis
    100654118 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654118 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100654118 (EDNRB)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Peptide
   Endothelin
    100654118 (EDNRB)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw 7tm_4 DUF2070
Other DBs
NCBI-GeneID: 100654118
NCBI-ProteinID: XP_010587703
UniProt: G3TAR5
LinkDB
Position
Unknown
AA seq 443 aa
MQSPSSLCRCALVALLLACGVAGVWGEERRLPPAGTTLPLLKMEEIMTYSTRTSWPRGSN
ASLPPSSALPQVPNGGRTAGARPRTLPPPPCQGSIEIKGTFKYINTVVSCLVFVLGIIGN
STLLRIIYKNKCMRNGPNILIASLALGDLLHITIDIPINVYKLLAGDWPFGPEMCKLVPF
IQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAVG
FDMITVDYNGSSLRICLLHPTQKTAFMQFYKTAKDWWLFSFYFCLPLAITALFYTLMTCE
MLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKHTLYDQNDPSRCD
LLSFLLVMDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKHS
CLKFKANDHGYDNFRSSNKYSSS
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcagtcgccttcaagtctgtgcagatgcgccctggtggcgctgcttcttgcctgtggc
gtcgcgggggtctggggagaggagagaagattaccgccggccgggaccaccctgccactc
ctgaagatggaagagataatgacgtattccactaggacctcttggccgagagggtccaac
gccagcctgccaccttcctcagcacttccgcaagtgcctaacggagggaggaccgcaggg
gcccggccacgcactcttcctcctcccccgtgccaaggatctatcgagatcaagggcacc
ttcaagtatatcaacacagtggtgtcctgcctcgtgtttgtgttgggcattatcgggaac
tccaccttgctgagaatcatttataagaacaagtgtatgcgaaatggacccaatatcttg
atcgccagcctggctctgggagacttgctgcacatcaccattgacattcccatcaatgtc
tacaagctcctcgcaggggactggccctttggacctgagatgtgcaagctggtgcctttc
atacagaaggcctccgtgggcatcactgtgcttagtctatgtgctctaagtattgacaga
tatcgagctgttgcttcttggagtcgaattaaaggaattggggtgccaaaatggacagcg
gtggaaattgttttaatttgggtggtctctgtggttctggctgtccctgaagccgtgggt
tttgatatgattacggttgactacaatggaagttctctgcgaatctgcttgcttcatccc
actcagaaaacagccttcatgcagttttacaagacagctaaagattggtggctgtttagt
ttctatttctgcttgccattggccattactgcacttttttataccctgatgacctgtgaa
atgttgagaaagaagagtggcatgcagattgctttaaatgatcacttaaagcagagacgg
gaagtggccaaaacagtcttttgcctggtgctcgtctttgccctgtgttggcttcccctt
catctcagcaggattttgaagcacactctttatgatcagaatgaccccagtagatgtgac
cttttgagctttttgttggtcatggactacatcggcatcaacatggcctccctgaactcc
tgcattaatccaatagctctgtatttggtgagcaaaagattcaaaaactgctttaagtca
tgcttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcattcc
tgcttaaagttcaaagctaatgaccacggatatgacaacttccgttccagtaataaatac
agctcatcttga

DBGET integrated database retrieval system