KEGG   Loxodonta africana (African savanna elephant): 100654159
Entry
100654159         CDS       T04351                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx1-like
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100654159
   05171 Coronavirus disease - COVID-19
    100654159
   05164 Influenza A
    100654159
   05162 Measles
    100654159
   05165 Human papillomavirus infection
    100654159
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_29 DUF4724
Other DBs
NCBI-GeneID: 100654159
NCBI-ProteinID: XP_010596962
LinkDB
Position
Unknown
AA seq 670 aa
MVRSKAEKATPDSAATTNRLPLLNGDANMANDTYMSEKKQDWGASNNLCSQYEEKVRPCI
DLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKK
LGHEDGWRGKVSYKDLEFDISDPSKVEEEINKAQNIIAGEGMGISQELINLEISSPNVPD
LTLIDLPGITRVAVGNQPADIGQQIKALIRKYIHKQETISLVVVPSNVDIATTEALSMAQ
EVDPDGERTIGILTKPDLVDKGTEEKVVDVVRNLVCHLKKGYMIVKCRGQQDIQDKLSLA
EALRREQAFFEDHDHFRVLLEEGKATVPLLAERLTTELITHICKSLPQLENQIKESHQKI
TEELQKYGVDIPEDENEKMFFLIDKINAFNQDILALVQGEESVGENDSRLFTKIRSEFLK
WSNEIERSFQDGHKIMCQHYWKFENQYRGRELPGFVNYRTFEMIIKDQIKNLEEPAVGML
HKVTDMVRLAFTDVSKNNFEEFFNLHRTAKSKIEDIKLEQEKEAEKSIRLHFQMEQIVYC
QDQVYRSALQKVREKDAEEEKRKKENYPYYQPKPSPSMESSIAEIFQHLLAYHQEFSNRI
SSHIPLVIQFFILKVYSQQLQKAMLQLLQDKDGYNWLLKEKSDTSDKRKFLKERLSRLAQ
ARRRLAKFPG
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggtgcgttctaaagcagaaaaagcaacacccgattcagctgctacaaccaaccgtctt
ccgttactaaacggagatgccaatatggcaaatgatacgtacatgtcagagaagaagcag
gactggggggcctcaaacaacctgtgcagccagtatgaggagaaggtgcgcccctgcatc
gacctcattgactccctgcgggccctgggcgtggagcaggacctagcactgcccgccatc
gctgtcatcggggaccagagctccgggaagagctcagtgctggaggctctgtcgggcgtt
gccctgcccaggggcagcggtattgttacgagatgtcccctggtgctgaaactgaaaaaa
cttgggcatgaagacggctggagagggaaggtcagctacaaggacttggagttcgacatt
tcagacccttcgaaggtggaagaggaaataaacaaagctcagaacatcattgctggggaa
ggaatggggatcagtcaagaactcattaatctggaaatcagctcccccaatgttccggat
ctgacattgattgaccttcctggtataaccagagtggctgtgggcaatcagccagctgac
attggacaacagatcaaagcactcattagaaagtacatccacaagcaggagacaatcagc
ttggtggtggtgccgagtaacgtggacattgcgaccacagaggcgctcagcatggctcag
gaggtggaccctgatggagaaagaaccataggtatcttgacgaagcctgacctggtggac
aaaggcacagaggagaaggtggtggatgtggtgcgcaacctcgtctgccacctgaagaag
ggctacatgatcgtcaagtgccggggccagcaggacatccaggacaagctgagcctggct
gaggccttgcggagagagcaggccttctttgaggaccatgaccattttagggttctcctg
gaggaagggaaggccaccgttccacttctggcagaaagactcaccaccgagctcatcacc
cacatctgcaaatctctgccccagttagagaatcaaatcaaggagagtcaccagaaaata
acagaggagttacagaagtacggtgtggacatccccgaggatgagaacgagaaaatgttc
tttctgatagataaaatcaatgcatttaatcaggacattcttgctttagtacaaggagaa
gagtcagtaggggagaatgacagccggctatttacaaaaatccgaagtgagttcctcaaa
tggagtaatgaaattgaaaggagtttccaggacggtcacaaaattatgtgtcaacattac
tggaaatttgaaaatcagtatcgtggcagagagctgccaggctttgtgaattatcgcact
tttgagatgattataaaagaccaaatcaaaaacctggaagaaccagctgtgggtatgctt
cacaaggtgactgatatggtccggcttgccttcacagatgtctcaaaaaacaattttgaa
gaattctttaacctgcacagaacagccaagtccaaaattgaggacattaaattagaacaa
gagaaggaagctgagaagtccatccggctgcacttccagatggagcagattgtctactgc
caggatcaagtttacaggagcgcgctgcagaaggtcagggagaaggacgcagaggaagag
aagaggaaaaaagagaattacccatactatcaaccaaaaccaagtccttccatggagtct
tccatagcggaaatctttcagcacctgctcgcctaccatcaggagttcagcaaccgcatc
tccagccacatccctctggtcatccagttcttcatcttgaaggtgtacagtcagcagctt
cagaaggccatgctgcagctgctgcaggacaaggatggctacaactggctcctgaaggag
aagagcgacaccagcgacaagaggaagttcctgaaggagcggctgtcgcggctggcccag
gctcggcgccgcctggccaagttccctggttaa

KEGG   Loxodonta africana (African savanna elephant): 100654447
Entry
100654447         CDS       T04351                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100654447
   05171 Coronavirus disease - COVID-19
    100654447
   05164 Influenza A
    100654447
   05162 Measles
    100654447
   05165 Human papillomavirus infection
    100654447
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED AAA_21 MMR_HSR1 AAA_29 DUF4724 OTCace ABC_tran
Other DBs
NCBI-GeneID: 100654447
NCBI-ProteinID: XP_003419023
LinkDB
Position
Unknown
AA seq 670 aa
MVRSKAEKATPDSAATTNRLLLLNGDANMANDTYMSEKKQDWGASNNLCSQYEEKVRPCI
DLIDSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRK
LGHEEGWRGKVSYQDLEFDISDPSKVEEEINKAQNIIAGEGMGISQELINLEISSPNVPD
LTLIDLPGITRVAVGNQPADIGRQIKALIRKYIHKQETISLVVVPSNVDIATTEALSMAQ
EVDPDGDRTIGILTKPDLVDKGTEEKVVDVVRNLVCHLKKGYMIVKCRGQQDIQDKLSLA
EALRREQAFFEDHDHFGVLLEEGKATVPLLAERLTTELITHICKSLPQLENQIKESHQKI
TEELQKYGVDIPEDENEKMFFLIDKINAFNQDILALVQGEESVGENQSRLFTKIRSEFLK
WSKEIEKNFQDGYNAMHEEISEFENQYRGRELPGFVNFRTFEKIIKKQIQKLEAPAMEML
HEVTDMVRLAFTVVSKKNFEEFFNLHRTAKSKIEDIKLEQEKEAEKSIRLHFQMEQIVYC
QDQVYRSALQKVREKDAEEEKRKKENYPYYQPKPSPSMESSIAEIFQHLLAYHQEVSNRI
SSHIPLVIQFFILKVYSQELQKAMLQLLQDKDGYSWLLKEKSDTSDKRKFLKERLSRLAQ
ARRRLAKFPG
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggtgcgttctaaagcagaaaaagcaacacctgattcagctgctacaaccaaccgtctt
ctgttactaaacggagatgccaatatggcaaatgatacgtacatgtcagagaagaagcag
gactggggggcctcaaacaacctgtgcagccagtatgaggagaaggtgcgcccctgcatc
gacctcatcgactccctgcgggccctgggcgtggagcaggacctagcactgcccgccatc
gctgtcatcggggaccagagctccgggaagagctcagtgctggaggctctgtcgggcgtt
gccctgcccaggggcagcggtattgttacgagatgtcccctggtgctgaaactgagaaaa
cttgggcacgaagaaggctggagagggaaggtcagttaccaggacttggagttcgacatt
tcagacccttcgaaggtggaagaggaaataaacaaagctcagaacatcattgctggggaa
ggaatggggatcagtcaggaactcattaatctggaaatcagctcccctaatgtcccagat
ctgacattgattgaccttcctggtataacaagggtggctgtgggcaatcagccggccgac
attggacgacagatcaaagcactcattagaaagtacatccacaagcaggagacaatcagc
ttggtggtggtgccgagtaacgtggacattgcgaccacagaggcgctcagcatggctcag
gaggtggatcctgatggagacaggaccataggtatcttgacgaagcctgacctggtggac
aaaggcacagaggagaaggtggtggatgtggtgcgcaacctcgtctgccacctgaagaag
ggctacatgatcgtcaagtgccggggccagcaggacatccaggacaagctgagcctggct
gaggccttgcggagagagcaggccttctttgaggaccatgaccattttggggttctcctg
gaggaagggaaggccaccgttccacttctggcagaaagactcaccaccgagctcatcacc
cacatctgcaaatctctgccccagttagagaatcaaatcaaggagagtcaccagaaaata
acagaggagttacagaagtacggtgtggacatccccgaggatgagaacgagaaaatgttc
tttctgatagataaaatcaatgcatttaatcaggacattcttgctttagtacaaggagaa
gagtcagtgggggagaatcagagccggctatttacaaaaatccgaagtgagttcctcaaa
tggagtaaagaaattgaaaagaatttccaggacggttacaatgctatgcatgaggaaatt
tcggaatttgaaaatcagtatcgtggcagagagctgccaggctttgtgaattttcggacg
tttgagaagattataaaaaaacagatccaaaaactggaagccccagctatggaaatgctt
cacgaagtgactgatatggtccggcttgccttcacagttgtctcaaaaaagaattttgaa
gagttctttaacctgcatagaacagccaagtccaaaattgaggacattaaattagaacaa
gagaaggaagctgagaagtccatccggctgcacttccagatggagcagattgtctactgc
caggatcaagtttacaggagcgcgctgcagaaggtcagggagaaggacgcagaggaagag
aagaggaaaaaagagaattacccatactatcaaccaaaaccaagtccttccatggagtct
tccatagcggaaatctttcagcacctgctcgcctaccatcaggaggtcagcaaccgcatc
tccagccacatccctctggtcatccagttcttcatcctgaaggtgtacagtcaggagctt
cagaaggccatgctgcagctgctgcaggacaaggatggctacagctggctcctgaaggag
aagagcgacaccagcgacaagaggaagttcctgaaggagcggctgtcgcggctggcccag
gctcggcgccgcctggccaagttccctggttaa

KEGG   Loxodonta africana (African savanna elephant): 100654728
Entry
100654728         CDS       T04351                                 

Gene name
MX2
Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05160  Hepatitis C
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100654728 (MX2)
   05171 Coronavirus disease - COVID-19
    100654728 (MX2)
   05164 Influenza A
    100654728 (MX2)
   05162 Measles
    100654728 (MX2)
   05165 Human papillomavirus infection
    100654728 (MX2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 Phasin_2 AAA_21 AAA_15 AAA_29 AAA_16 CHDNT
Other DBs
NCBI-GeneID: 100654728
NCBI-ProteinID: XP_023414878
LinkDB
Position
Unknown
AA seq 733 aa
MPKVHKPCPQQNQNPLSSQYHPEKEMSSRQRPPPSFRPAQKQIMSPPNQQAGDVTMHFTS
LMLNEQTTSMPPGENRSQPPLGESRRQPPPGENRSQPWAKWTKSILHSQYEEKVRPYIDL
IDSLWTLGVEQDLALPAIVVIGDQSSGKSSVLEALSGVALPRGSGITTRCPLVLKLKRQP
CEYEWRGKLSYRDKELHLHSPEEVEQVIHKAQNAIAGHGVSISHELIHLEITSPEVPDLT
LIDLPGIARVAMGNQPQDIGLQIKSLITKYIKRQETINLVVMPCNVDIATTEALNMAKEV
DPDGDRTIGILTKPDLVDKGLETGILNVVRNLTYHLKKGYMIVRCRGQQEITDKLSLAEA
TKREINFFQTHPNFRVLLEEGRATVPCLAERLTTELIVHIKKSLPLLGQQIQESHQRATE
ELRHYGTEVPDKETGKMFFLIEKVKVFNRDVEKLVEGEEAVKENEIRLYNKIRMEFKTWD
HVLAANTEKVKNIVHEEVSKYENQYRGKELPGFINYQTFVAIVRQYIQQLVDPALNMLQK
VTEIVQQAFIAQAKTNFREFPNLNQTAQDLIEKIKMRQVEAAENLVQLQFSMEQLVFCQD
ELYRAILKEVRERMSNPLENNPQLFQRNQLNVFGASVTDPSTSSITEIGVHLNAYFTETS
RRLANQIPLIIQFFLLQENSDCLQKSMMHVLQEKEGYGWLLQEQTETAAKRRLLKERIYR
LTQARCTLRQFST
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgcctaaagtccacaagccttgtccacagcagaatcaaaatccactttcttcccaatac
catcctgaaaaagaaatgagttcccgtcaacggccaccgccatcattccgcccagcacaa
aaacaaatcatgtctcccccaaaccagcaggcaggagacgtcaccatgcacttcacttca
ctgatgctgaacgaacagaccaccagcatgccaccaggagagaacaggagccagccacca
ctaggagaaagtaggagacagccaccaccaggagagaacaggagccagccgtgggcaaag
tggaccaagagcatcctgcacagccagtacgaggagaaggtgcgcccctacatcgacctc
attgactccctgtggaccctgggcgtggaacaggacctggcactgcccgccatcgttgtc
attggggaccagagctccggaaagagctcggtactggaggctctgtcgggcgtcgccctg
cccaggggcagcggtattaccaccaggtgtcctctggtgctgaaattgaaaaggcagccg
tgtgagtatgagtggaggggaaaactcagttatcgagacaaggaactccacctgcacagc
ccggaggaggtggaacaggttatacacaaagcccagaatgccatcgctggtcatggtgtg
agcattagtcacgagctcattcatctggagatcacctccccggaggttccagacctgacc
ctcattgatcttcctggcatcgccagggtggccatgggaaatcagccccaggacatcgga
ctacagatcaagtcgctcatcacaaaatacatcaaaagacaggagacaatcaacttggtg
gtgatgccctgtaacgtggacatcgcgaccacggaggcactcaacatggctaaggaagtg
gaccctgatggagacaggaccatagggatcctgaccaaaccagatctagtagacaagggc
ttggaaacaggtatcctgaacgtggtgcggaacctcacgtaccacctcaagaagggctac
atgattgtgaggtgccggggccagcaggagatcaccgacaagctgagcttggcagaggcc
actaagagggaaataaacttcttccaaacacatccgaatttcagagtcctcctggaggaa
ggaagggccacggtgccctgtctggccgagagactgaccacggagctcatcgtgcacatc
aaaaaatcactcccattattaggacagcaaatccaggagagccaccagagggcgacagag
gagctgcgtcattatggcaccgaggtcccagacaaggaaacaggtaaaatgttctttctg
attgagaaagtcaaggtgttcaatcgagatgtcgaaaaactagtagaaggagaagaagct
gtcaaggagaatgagatacgattatataacaaaatcagaatggagtttaaaacctgggat
catgtactggcagccaataccgaaaaagtgaaaaatatagttcatgaagaagtctcaaaa
tatgagaatcagtaccggggcaaagagcttcctggatttatcaactaccagacgtttgtg
gccattgtgcgacagtatatccaacagctggtagacccagccctgaacatgctccagaaa
gttactgaaattgtccagcaggctttcattgctcaggccaaaaccaatttcagagaattt
cccaacctgaatcaaacagcccaggacctgatcgaaaagataaaaatgagacaagtagag
gcagcagaaaatctggtccagcttcagttcagcatggagcagctggttttttgtcaagat
gagctttaccgtgcgattctgaaggaagtccgagaacggatgtctaacccactggaaaat
aatccacagctttttcagaggaatcagttgaatgtttttggtgccagcgtaacggatcct
tcaacttcctctattactgaaatcggtgtacacctgaatgcgtatttcacggaaaccagc
aggcgtcttgccaaccagatcccgctcataattcagttcttcctgctccaagagaatagc
gactgcctgcagaagtccatgatgcacgtattacaggaaaaagagggctacggctggctg
ctgcaggagcaaacggagacggccgccaagaggaggctccttaaggagcggatctaccgg
ctgacgcaggcgcggtgcacgctccgtcagttctccacttag

DBGET integrated database retrieval system