KEGG   Loxodonta africana (African savanna elephant): 100654178
Entry
100654178         CDS       T04351                                 

Definition
(RefSeq) cytochrome P450 11B2, mitochondrial-like
  KO
K00497  steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00140  Steroid hormone biosynthesis
lav01100  Metabolic pathways
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Module
lav_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100654178
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100654178
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100654178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lav00199]
    100654178
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     100654178
Cytochrome P450 [BR:lav00199]
 Cytochrome P450, animal type
  CYP11 family
   100654178
SSDB
Motif
Pfam: p450 LSM_int_assoc
Other DBs
NCBI-GeneID: 100654178
NCBI-ProteinID: XP_003422469
LinkDB
Position
Unknown
AA seq 502 aa
MVLRVQAGMWTTGPRLALHRAQALGTRACPARQAVLPFEAIPQCPGNKWLRMLRIWKEQG
QESLHLEMQKHFEELGPIFRYDVGGVSMVNVMLPKDAEQLQQVDGLHPCRMPLEPWVIYR
HHHGHKLGVFLMNGPEWRHNRLRLNPDLLEPRNIQRFMPLVDTVAQDFIKALRKRVLQNA
RGSLTLDVQSNISLYSIEASNFALYGERLGLLGPNPSPASLDFLQALKAVLKSTTQLSFM
PQSLSRWASANVWAEHFRSWDTIFQYANKAMYNTYQELALGRPQHYSGIVAELLLRSDLP
LDTIKANAVDLTAGSADTTAYTLLMTLFELARNSDVQQALRQESLEAEATIRESSHRVTS
ELPLLRAALKETLRLYPVGLTLQRRVKSDLVLQNYHVPAGTLVFLNLYSLGRNPAVFPRP
ERYDPQRWLTKSSSSNFRHLAFGFGVRQCLGRRLAEAELLLFLHHVLKNFLVKTVSPEDL
KMVYRFVLMPSTYPLLTFQAIN
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggtgctcagggtgcaggcaggcatgtggaccacggggccccggctggccctgcacagg
gcccaggcactgggcaccagggcctgtccggcccgccaggcagtgctgccctttgaagcc
atcccccagtgtcccggcaacaagtggctgaggatgctgcgtatctggaaggaacagggc
caggagagcctgcacctggagatgcagaaacacttcgaggagctggggcccatcttcagg
tatgacgtgggaggggtgtccatggtgaacgtgatgctgcccaaggacgcagagcagctg
cagcaggtggacggcctgcacccctgcaggatgcccttggagccctgggtgatctaccga
caccatcacgggcacaaactcggcgtgttcttgatgaacgggcccgaatggcgccacaac
cggttgcggctgaacccagacctgctcgaacccagaaatatccagaggttcatgcccctg
gtggacacggtggcccaagacttcatcaaggccctgaggaagagagtgttgcagaatgcc
cgagggagcctgaccctggacgtccagtccaacatctccctctacagcatcgaagccagc
aactttgccctgtatggagagcggctgggcctccttggccccaaccccagcccggccagc
ctggacttcctccaggccttgaaggctgtgttgaaatccaccacgcagctctccttcatg
ccgcagagcctgtcccgttgggccagcgccaacgtgtgggcagagcacttccggtcctgg
gataccatattccagtatgccaacaaagccatgtacaacacctaccaagagctggcgctt
ggccgcccgcagcactacagcggcatcgtggcagagctgctcttacgctcagacctgccc
ctggataccatcaaggccaacgccgtggacctcaccgcagggagcgcagacacgacagcc
tacaccttgctgatgactctcttcgagctggctcgaaactccgatgtgcagcaggccctg
cgccaggagagcctggaggcggaggccaccatcagggaaagctcccacagggtcacctct
gagctgccgctgctgcgagctgccctcaaggagaccctgcggctgtaccccgtgggatta
actctgcagaggcgggtaaagtcggacctggtgctgcagaactatcacgttccggccggg
acattagtcttcttgaacctctactccctgggtcgaaaccccgcggtattcccgaggccc
gagcgctacgacccccagcgctggctgaccaagtcctccagctctaacttccgtcacctg
gccttcggcttcggggtgcgccagtgcctggggcggcggctggcagaggcggagctgctg
cttttcctgcaccacgtgctgaagaacttcctggtgaagactgtatcccccgaggaccta
aagatggtctaccgcttcgtgctgatgccctccacctatcccctcctcaccttccaggcc
atcaactag

DBGET integrated database retrieval system