KEGG   Loxodonta africana (African savanna elephant): 100654322
Entry
100654322         CDS       T04351                                 

Gene name
RPS6KA6
Definition
(RefSeq) ribosomal protein S6 kinase alpha-6 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04114  Oocyte meiosis
lav04150  mTOR signaling pathway
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04931  Insulin resistance
lav05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100654322 (RPS6KA6)
   04150 mTOR signaling pathway
    100654322 (RPS6KA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100654322 (RPS6KA6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100654322 (RPS6KA6)
  09156 Nervous system
   04720 Long-term potentiation
    100654322 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    100654322 (RPS6KA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    100654322 (RPS6KA6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100654322 (RPS6KA6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100654322 (RPS6KA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100654322 (RPS6KA6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100654322 (RPS6KA6)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100654322 (RPS6KA6)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100654322 (RPS6KA6)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100654322 (RPS6KA6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo Pkinase_C YrbL-PhoP_reg APH Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 100654322
NCBI-ProteinID: XP_003412752
LinkDB
Position
Unknown
AA seq 747 aa
MLRFAPRDEPWDQEMEVFGGGSPGASPSEVNGLKMVDEPMEEGEADSSSEEGDFKEIHIT
HHVKEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRV
RTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFY
LAELALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVE
YMAPEVVNRRGHSQSADWWSFGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSA
EAQSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWNKLYKREVQPPFKPASGKPDDTF
CFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSVAEEYKITPITSASVLPIVQINGN
AAQFSEVYEVKEDIGVGSYSVCKRCIHTTNNMEFAVKIIDKSKRDPSEEIEILMRYGQHP
NVITLKDVYDDGRYVYLVTDLMKGGELLDRILKQKCFSEREASDVLYVITKTVDYLHCQG
VVHRDLKPSNILYMDESANADSIKICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQG
YDAACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKD
LLSHMLHMDPHLRYTTEQILKHSWITHRDQLPADQPNRNDASHIIKGAVVATYSALSHKT
FQPVLEPVAASSLAQRRSMKKRTSTGL
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgctacggttcgctcctcgggacgagccctgggaccaagaaatggaggtgtttggcggc
ggcagccccggtgcgagccccagcgaggtaaatggtcttaaaatggttgatgaaccaatg
gaagaaggagaagcagattctagcagtgaagaaggagattttaaagaaatccatattact
catcacgttaaggaaggatatgagaaagcagatcctgcacagtttgaattgctcaaggtt
cttggtcagggatcatttggaaaggtttttcttgttaggaagaagactggtcctgatgct
gggcaactctatgcaatgaaggtgttgaaaaaagcttctttgaaagttcgagacagagtt
cggactaagatggagagggatatactggtggaagtaaatcacccatttattgtcaaattg
cactatgcctttcagactgaagggaagttatacttaatattggattttctcaggggagga
gatgtcttcacaagattatctaaagaggttctgtttacagaggaagacgtgaaattctac
ctcgcagaactggcccttgctctggatcatctgcaccaattaggaattgtatatagagac
ctgaagccagaaaacattttgcttgatgaaataggacatatcaagttaacagattttgga
ctcagcaaggagtcagtagaccaagaaaagaaggcttactcattttgcggtacagtagag
tacatggctccagaagtagtaaataggcgaggccattcccagagtgctgactggtggtca
tttggtgtgcttatgtttgaaatgcttactggtactctgccatttcaaggtaaagacaga
aatgagaccatgaatatgatactgaaagcaaaacttggaatgcctcagtttcttagtgct
gaagcacaaagcctcctaaggatgttattcaaaagaaatccagcaaatagactgggttca
gaaggagttgaggaaatcaaaagacatcttttttttgcaaatattgactggaataaatta
tataaaagagaagttcaacctccttttaaacctgcttctggaaaaccagatgatactttt
tgctttgatcctgaatttactgcaaaaacacctaaagattctcctggtttgccagccagt
gctaatgctcatcaactcttcaaaggattcagctttgttgcaacatctgttgcagaagaa
tataaaatcactcctatcacaagtgcaagtgtactaccaattgtccagataaatggaaat
gctgcacaatttagtgaggtatatgaggtgaaagaggatatcggggttggctcctattct
gtttgcaagcgatgcatacatacaactaacaacatggaatttgcagtgaagatcattgac
aaaagtaagagagacccctccgaagaaattgaaattttgatgcgctatggacaacacccc
aacgttatcactttaaaggatgtctatgatgatggtagatatgtttaccttgttacggat
ttgatgaaaggaggagagctacttgaccgtattctcaaacaaaaatgtttctcagaacgc
gaggctagtgatgtactgtatgtaataactaaaacagttgactatctacattgtcaagga
gttgttcatcgtgatcttaaacctagtaatatcttatacatggatgaatcagccaatgca
gattccataaagatctgtgattttgggtttgcaaaacaacttcggggtgaaaatggactt
ctcttgactccatgctacactgcaaattttgtagcacctgaggttcttatgcaacaggga
tatgatgctgcatgcgatatttggagtttgggagtccttttttacacaatgttggctggc
tatactccatttgctaatggccccaatgatactcctgaagagatactgctgcgtataggt
aatggaaagttctctttgagtggtggaaactgggacaatatttcagatggagcaaaggat
ttactttcccatatgcttcatatggacccacatttgcggtacactacagaacaaatacta
aaacactcatggataacccacagagaccagttgccggctgatcagccaaatagaaatgat
gcatcacatattattaagggagcagtagttgccacatattcagctctgagtcacaagacc
tttcagccagtcctagagcctgttgctgcttcaagcttagctcaacgacggagcatgaaa
aagcgaacatcaactggtctataa

KEGG   Loxodonta africana (African savanna elephant): 100658801
Entry
100658801         CDS       T04351                                 

Gene name
RPS6KA2
Definition
(RefSeq) ribosomal protein S6 kinase alpha-2 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04114  Oocyte meiosis
lav04150  mTOR signaling pathway
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04931  Insulin resistance
lav05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100658801 (RPS6KA2)
   04150 mTOR signaling pathway
    100658801 (RPS6KA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100658801 (RPS6KA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100658801 (RPS6KA2)
  09156 Nervous system
   04720 Long-term potentiation
    100658801 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    100658801 (RPS6KA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100658801 (RPS6KA2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100658801 (RPS6KA2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100658801 (RPS6KA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100658801 (RPS6KA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100658801 (RPS6KA2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100658801 (RPS6KA2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100658801 (RPS6KA2)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100658801 (RPS6KA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg RIO1
Other DBs
NCBI-GeneID: 100658801
NCBI-ProteinID: XP_003419259
LinkDB
Position
Unknown
AA seq 733 aa
MDVTMKKFTVRRFFSVYLRKKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGPDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHGLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSMEAQSLLRALFKRNPSN
RLGAGMDGVEEIKRHPFFVTIDWNKLYRKEIKPPFKPAVGRPEDTFHFDPEFTSRTPTDS
PGVPPSANAHHLFRGFSFVASSLVQEHSQQDPHKVTVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDAEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
YVYLVMELMRGGELLDRILRQRCFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
MDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDVWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTVVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSSLA
QRRGMKRLTSTRL
NT seq 2202 nt   +upstreamnt  +downstreamnt
atggacgtgaccatgaagaagttcacggtgcgcaggttcttctccgtctatctccgcaag
aagtcgcgctccaagagctccagtctcagccggctggaggaagaaggcgttgtgaaggaa
attgacatcagccatcatgtgaaagaaggatttgagaaggcagacccttcacagtttgaa
ctgctcaaagttctaggacagggatcctacgggaaggtgttcctggtgaggaaggtgaag
ggacctgatgctgggcagctctacgccatgaaagttcttaagaaagcgaccttaaaagtc
cgggaccgcgtccgctccaagatggagagggacattctggccgaagtgaaccacccattc
attgtgaagcttcattacgcctttcagacggaaggaaagctgtatctgatcctggacttc
ctgcggggaggggacctgttcaccagactctccaaagaggtaatgttcactgaagaggat
gtcaagttctacttagcagaactagccttggccttagaccacctgcacggcctggggatc
atttacagggatctgaagcctgagaacatcctcctggatgaagaaggacacattaagatc
acagatttcggcctgagcaaggaggccatcgaccatgacaagagggcgtactcgttctgt
gggaccatcgagtacatggcacccgaggtggtgaaccggcggggccacacgcagagcgcc
gactggtggtcctttggcgtgctcatgttcgagatgctgacgggctctctgccgttccag
gggaaggaccggaaggaaaccatggcgctcatcctcaaagccaagctagggatgccccag
ttcctcagcatggaagcccagagtctgctgagagcgctcttcaagcggaaccccagcaac
cggctaggtgctggcatggatggagtcgaggaaattaaacggcaccccttcttcgtgacc
atagactggaacaagctgtacaggaaggagatcaagccgcccttcaagccagcggtgggc
aggcccgaggacaccttccatttcgaccccgagttcacatcaaggacgcccacagattct
ccaggggtgccccccagtgccaatgcacaccatctgtttagaggattcagttttgtggca
tcgagcctggtccaggagcactcgcagcaagacccccacaaggtcacagttcaccccatc
gtgcagcagctgcatgggaacaacatccacttcaccgatggctatgagatcaaggaagac
atcggggtgggctcctactccgtgtgtaagcgatgtgtgcacaaagccacagacgcagag
tacgctgtcaagatcatcgacaagagtaaaagggacccctcggaagagattgagatcctc
ctgagatacggccaacacccaaacatcatcactctcaaagacgtctacgatgacgggaag
tacgtgtacctggtgatggagctgatgcgtggcggtgagctcctggaccgcatcctgcgg
cagcggtgtttctcggagcgtgaggccagtgacgtgctgtgcaccatcaccaagaccatg
gactacctgcactcccagggggtggtgcaccgagacctgaagccaagtaacatcctctac
atggacgagtctggaaaccccgagtccatcagaatctgtgactttgggtttgccaagcaa
ctgcgagctgagaacgggctgctgatgacaccctgctacacggccaactttgttgccccc
gaggtcctaaaacggcaaggctatgatgcagcatgcgatgtgtggagtctggggatcctg
ttgtacaccatgctggccggatttaccccttttgcaaatgggccagatgatacccctgag
gagattttggcgaggattggcagtgggaagtatgccctctccggagggaactgggactct
atatctgatgcagcaaaggatgtcgtatccaagatgctccacgtggaccctcaccagcgc
ctgacggtggttcaagtcctaaagcatccatggattgtgaacagagaatacttgtcccaa
aaccagctcagcagacaagacgtccacctagtgaagggggccatggctgccacctacttt
gctctgaacaggacacctcaggcgcccaggctggagccggtgctctcgtccagcttggca
cagcgccgcggcatgaagagactgacatctacacggttgtag

KEGG   Loxodonta africana (African savanna elephant): 100659843
Entry
100659843         CDS       T04351                                 

Gene name
RPS6KA3
Definition
(RefSeq) ribosomal protein S6 kinase alpha-3
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04114  Oocyte meiosis
lav04150  mTOR signaling pathway
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04931  Insulin resistance
lav05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100659843 (RPS6KA3)
   04150 mTOR signaling pathway
    100659843 (RPS6KA3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100659843 (RPS6KA3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100659843 (RPS6KA3)
  09156 Nervous system
   04720 Long-term potentiation
    100659843 (RPS6KA3)
   04722 Neurotrophin signaling pathway
    100659843 (RPS6KA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100659843 (RPS6KA3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100659843 (RPS6KA3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100659843 (RPS6KA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100659843 (RPS6KA3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100659843 (RPS6KA3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100659843 (RPS6KA3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100659843 (RPS6KA3)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100659843 (RPS6KA3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Kdo APH tRNA-synt_1f
Other DBs
NCBI-GeneID: 100659843
NCBI-ProteinID: XP_010594047
LinkDB
Position
Unknown
AA seq 726 aa
MAVESPSDSAENGQQIMDEPMGEEEINLQTEEGSIKEIAITHHVKEGHEKADPSQFELLK
VLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVK
LHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYR
DLKPEKYLINSIFILADFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSF
GVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAG
PDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPEFTAKTPKDSPGIPP
SANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTDGYEVKEDIGVGSYS
VCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVYVVTE
LMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNP
ESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTG
YTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVL
RHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKK
ITSTAL
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggctgtggagagcccgtccgacagcgcagagaatggacagcaaattatggatgaacct
atgggagaggaggagattaatctacaaactgaagaaggcagcatcaaagaaattgcaatc
acgcatcatgtaaaggaaggacatgaaaaggcagatccttctcaatttgaacttttgaaa
gtattagggcagggatcatttggaaaggtttttttagttaaaaaaatctcaggctctgat
gctagacagctttatgccatgaaagtattgaagaaggccacgttgaaagttcgagaccgt
gtgcggacaaaaatggagcgtgatatcttggtagaagttaaccatccttttattgtcaag
ttgcattatgcttttcaaactgaagggaagctgtatcttattttggattttctcagggga
ggagatttgtttacacgcttatccaaagaggtgatgttcacagaagaagatgtcaaattc
tacttggctgaacttgcacttgctttagaccatctacatagcctgggaataatctataga
gacttgaaaccagaaaaatatttaataaattccatatttatcttggcagattttggccta
agtaaagagtctattgaccatgaaaagaaggcgtattctttttgtggaactgtggaatat
atggctccagaagtagttaaccgtcggggccatactcagagtgccgattggtggtctttt
ggtgtgctgatgtttgaaatgctcactggtacactacctttccaaggaaaagatcgaaaa
gaaacaatgactatgatacttaaggccaaacttgggatgccacagtttttgagtcctgaa
gcccagagtcttttacggatgcttttcaaacgaaatcctgctaacagactaggcgcagga
ccagatggagttgaagaaattaaaagacattcatttttctcaacgatagactggaataaa
ttatacagaagagaaattcatccaccttttaaacctgcaactggcagacctgaagataca
ttctatttcgaccctgaatttactgcaaaaactcccaaagactcacctggcattccccct
agtgccaatgcacatcagctcttccggggatttagttttgttgcaatcacttcagacgat
gaaagccaagcaatgcagacagttggtgtacattcaattgttcagcagttgcacaggaac
agtattcagtttactgatggatatgaagtaaaagaagatattggagttggctcctactct
gtttgcaagagatgtatacataaagccacaaacatggagtttgcagtgaagattattgat
aaaagcaagagagacccaacagaagaaattgaaatccttcttcgttatggacagcatcca
aacattattactctaaaggatgtatatgatgacggaaaatacgtgtatgtagtaacagaa
cttatgaaagggggtgaattactggataaaattcttagacagaaatttttctctgaacga
gaggccagtgctgtcctgtttactataaccaaaactgttgaatatcttcacgcacaaggg
gtggttcacagagacttgaaacctagcaacattctttatgtggatgaatctggtaatcca
gaatctattcgaatttgtgattttggttttgcaaaacagctcagagctgaaaacggtctt
ctcatgactccttgttatactgcaaattttgttgcaccggaggttttaaaacgacaaggc
tatgatgctgcttgtgatatatggagccttggtgtcctcctgtatacaatgcttaccggt
tacactccatttgcaaatggccctgatgatacgccagaggaaatattggcacgaataggt
agtggaaaattctccctcagtggtggttactggaattctgtttcagatacagcaaaggac
ctggtgtcaaagatgcttcatgtagatcctcatcagaggctgactgctgccctcgtgctc
agacatccctggatcgtccactgggaccaactgccgcagtatcaactcaacagacaggac
gcaccccacctagtaaagggtgccatggcagctacatactctgctttaaaccgtaaccag
tcaccagttttggaaccagtaggccgctctactcttgctcagcggagaggtattaaaaaa
atcacctcaacagctctgtga

KEGG   Loxodonta africana (African savanna elephant): 100676062
Entry
100676062         CDS       T04351                                 

Gene name
RPS6KA1
Definition
(RefSeq) LOW QUALITY PROTEIN: ribosomal protein S6 kinase alpha-1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04114  Oocyte meiosis
lav04150  mTOR signaling pathway
lav04714  Thermogenesis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04931  Insulin resistance
lav05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100676062 (RPS6KA1)
   04150 mTOR signaling pathway
    100676062 (RPS6KA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100676062 (RPS6KA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100676062 (RPS6KA1)
  09156 Nervous system
   04720 Long-term potentiation
    100676062 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    100676062 (RPS6KA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100676062 (RPS6KA1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100676062 (RPS6KA1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100676062 (RPS6KA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100676062 (RPS6KA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100676062 (RPS6KA1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100676062 (RPS6KA1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100676062 (RPS6KA1)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100676062 (RPS6KA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Pkinase_C Kdo APH
Other DBs
NCBI-GeneID: 100676062
NCBI-ProteinID: XP_010593411
LinkDB
Position
Unknown
AA seq 745 aa
MEQDPKSPRLRLWALLPWLPRKQRPRISQTSLPASGPGSGPRRDSDEGILKEISITHHVK
AGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKM
ERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAEL
ALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAP
EVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQS
LLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYF
DTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRATQAPLHSVVQQLHGKN
LVFSDGYVVKETIGVGSYSVCQRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPN
IITLKDVYDDGKHVYLVTELMRRGELLDKILRQKFFIXREASFVLYTITGTVSWLHPLDG
VVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQG
YDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKD
LVSKMLHVDPHQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKP
TPQLKPIESSILAQRRVRKLPSTTL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcaggatcccaagtcgccccgtctgcggctttgggccctgctcccctggctgccc
aggaagcagcggcccaggatcagccagacctcgctgcctgcctcaggccctggctctggc
ccccggcgggactcggatgagggcatcctcaaggagatctccatcacacaccatgtcaag
gctggctctgagaaggctgacccatcccatttcgagctcctcaaggttctgggccaggga
tcctttggcaaagtcttcctggtaaggaaggtcacccgacctgatagcggacatctatat
gctatgaaggtactgaagaaggcaacactgaaagtccgtgaccgggtccggaccaagatg
gagagagacatcctggctgacgtcaaccacccatttgtggtgaagctgcactacgccttc
cagaccgagggcaagctctatctcattctggacttcctgcgtggcggagacctcttcaca
cggctctctaaggaggttatgttcacagaggaggatgtgaagttctacctggccgagctg
gctttgggcctggaccacctgcacagtctggggattatctacagagacctcaagccggag
aacattcttctggatgaggagggccacatcaaactaactgacttcggcctgagcaaggag
gccattgaccatgagaagaaggcctactccttctgcgggacagtggaatacatggccccc
gaggtcgtcaaccgccaaggccacacccacagtgcagactggtggtcctatggggtgttg
atgtttgagatgctgacgggctccctgcccttccaggggaaggaccggaaggagaccatg
acactgattctaaaggcaaagctaggcatgccccagtttctgagcacagaagcccagagc
ctcctgagggccctgttcaagcggaatcctgccaaccggctcggctctggccccgacggg
gcagaggagatcaagcggcacgtcttctactccaccattgactggaataagctgtaccgt
cgcgagatcaagccacccttcaagccagcagtggctcaacccgatgacaccttctacttt
gacacagagttcacatcccgcacgcccaaggactccccgggtatcccccctagtgctggc
gcccatcagctgttccgtggcttcagcttcgtggccaccggcctgatggaggacgacggc
aagcctcgggccacgcaggcaccactgcactcagtggtccagcaactccacgggaagaac
ttggtttttagtgatggctacgtggtaaaggagacgattggtgtgggctcctactctgtg
tgtcagcgctgtgtgcacaaggccaccaatatggagtatgccgtcaaggtcattgacaag
agcaagcgggacccctcggaagagatcgagattctcctgcggtacgggcagcatcccaac
atcatcaccctgaaagatgtgtacgatgatggcaaacacgtgtacctggtgacggagctg
atgcgaaggggggagctgctggacaaaatcctgcggcaaaagttcttcatctgacgggag
gccagcttcgtcctgtacaccatcactggcactgtgtcatggctgcaccctttagatggg
gttgtacacagggacctcaagcccagcaacatcctgtacgtggatgagtctgggaacccc
gagtgcctgcgcatctgtgacttcggcttcgccaagcaactgcgggctgagaacgggctc
ctcatgacgccttgctatacagccaacttcgtggcccctgaggtgctgaagcgccagggc
tacgatgagggctgtgacatctggagcctgggcattctgctgtataccatgctagcggga
tacactccatttgccaacgggcccagtgacacaccagaggaaatcctgacacggatcggc
agtgggaagttcaccctcagtgggggaaactggaacacagtttcagaaacagccaaggac
ttggtatccaagatgctgcacgtggacccccaccagcgcctcacagctaagcaggtcctc
cagcacccatggatcacccagaaagacaagctaccccagagccagctgtcccaccaggac
ctgcagcttgtgaagggagccatggcagccacgtactccgcactcaatagctccaagccc
actccccagctgaagcccattgaatcatctatcctggcccagcggcgggtgaggaagttg
ccgtccaccaccctgtga

DBGET integrated database retrieval system