KEGG   Loxodonta africana (African savanna elephant): 100654429
Entry
100654429         CDS       T04351                                 

Gene name
ITGA2B
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100654429 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100654429 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100654429 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100654429 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100654429 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100654429 (ITGA2B)
   04611 Platelet activation
    100654429 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    100654429 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654429 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100654429 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100654429 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    100654429 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100654429 (ITGA2B)
   05414 Dilated cardiomyopathy
    100654429 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100654429 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100654429 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100654429 (ITGA2B)
   04515 Cell adhesion molecules [BR:lav04515]
    100654429 (ITGA2B)
   04090 CD molecules [BR:lav04090]
    100654429 (ITGA2B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100654429 (ITGA2B)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100654429 (ITGA2B)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100654429 (ITGA2B)
CD molecules [BR:lav04090]
 Proteins
  100654429 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100654429
NCBI-ProteinID: XP_003414547
LinkDB
Position
Unknown
AA seq 1038 aa
MARALCPLXCLWLLGWAQLLLGPXGTPPTWALNLDLMRLTVYTGPNGSHFGFSLDFYKDS
KGSVAIVVGAPRALGPRREETGGVFLCPWKAEGGQCTSLSFHLTDDNQNVGYQTLQTFKA
GQGLGASVVSWRDNVVACAPWQHWNVLEKTEEAEKTPVGSCWVAHLQSGSRAEYSPCRAR
IMSKIYEQNRFMLDRRYCEVGFSSVVTQAGELVLGAPGGYYFLGLLVRAPVANIVSSYSP
GTLLRSVPSQSFTSDSSSQEFFDGYRGYSVAVGEFDGSPNTTEYVFGAPTWSWTLGAVEI
LNSDHRTLQRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMDSRSDRKLAEVGRVY
LYLQPRGTYVLGAPNLLLTGTQLYGRFGSAIAPLGDLDRDGYNDLAVAAPYGGPSGRGQV
LVFRGQSEGLSSRPSQVLDSPFPKGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVAVYR
AQPVVMASVQLLVQDSLNPAVKDCILTQTNKAVSCFNIQMCVGATGHNITEKLHLNAELQ
LDRQKPRQGRRVLLLGSQQASTTLSLDLSRRHSPICHTTKAFLRDEADFRDKLSPIVFSL
NVSLQPEEAGLAPALLLLGDTHVQEQTRIILDCGEDHLCVPQLQLTGEMRGSPLLIGADS
VLKLQMDAVNEGEGAYEAELVVHLPPGAYYMQALSDIQGYERLICNQKKENETKMVLCEL
GNPMKKDARIQITMLLSVENLEEVGEYMSFQLQIRSKNSQNPNSEMVLLNVPVWAEAHVE
LRGNSFPASLVVPAEEGDRKTESSDSWGPRVEHTYELHNKGPGAVSGLRLNLQFPSQSQP
SDLLYILDVQPQGGLQCSPQPSPKPLQLDQRLPTPSQPPVYPEHHKRERRQALQPGSQQP
SELQDPILVNCDSAPCTVVQCELQEMAPGQRAMVTVLAFLWLPSLRQRPLDQFVLQSHAW
FNVSALPYAVPALSLPRGEALVQTQLLRVLEERDVPIWWILVGMLGGLLLLTLLVLAMWK
VGFFKRNRPPLEEEDEEE
NT seq 3117 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccactgncatgcctctggctcctggggtgggcacagctgctc
ttaggaccgnatggtacccctccaacctgggccttgaacctggacctgatgcggctcact
gtctacacaggccccaatggtagccactttgggttttcactggacttctacaaggacagc
aaaggaagcgtggccatcgtggtgggcgcccctcgggccttgggtcctagacgagaggaa
actggcggtgtgttcctgtgcccctggaaggccgagggtggccagtgcacctcgctgtcc
ttccacctcacggatgacaaccaaaacgtaggctaccaaaccctccaaaccttcaaggcc
gggcaaggactgggggcgtcggtcgtcagctggagagacaacgttgtggcctgtgctccc
tggcagcattggaatgtgctagaaaagaccgaggaggccgagaagacgcctgtaggtagc
tgctgggtggctcatctccagagcggcagccgggcggagtactcgccctgccgggcccgc
atcatgagcaagatttacgaacaaaatcgttttatgctggacagacgctactgcgaagtg
ggcttcagctcagtggtcacccaggctggggagctggtgcttggggcccccggtggctat
tatttcttagggctcctggtccgggctccagtcgccaatatcgtctcgagttacagtccg
ggcaccctcttgcggtccgtgcccagccagagcttcacctccgactccagcagccaagag
ttcttcgacggctaccgggggtactcggtggccgtgggcgagttcgacgggagtcccaac
actacagagtatgtcttcggtgcccccacctggagctggaccctgggagcggtagagatt
ttgaactcggaccaccggacgctgcaacggctacatggggagcagatggcttcgtatttc
gggcactcggtggctgtcactgatgtcaatggggacgggagacatgacctgctggtgggc
gcaccactgtacatggacagccggtctgaccgaaagctggcagaggtggggcgcgtgtac
ttgtacctgcagccccgtggcacctatgtgctgggcgcccccaacctcctgctgactggc
acccagctctacggacgatttggctcagccatcgcccccctgggtgacctcgaccgggat
ggctacaatgatcttgcagtggctgccccctatgggggtcccagtggccggggccaggtg
ctagtgtttcggggtcagagtgaggggctgagctcacgcccatcccaggtcctggacagc
cccttccccaaaggctccggctttggcttctccctgcgaggtgccacagacattgatgac
aacggatacccagacctgctggtgggagcttacggggccagcaaggtggctgtgtacaga
gctcagcctgtggtgatggccagtgtccagctgctggtgcaagattcactgaaccctgca
gtgaaggattgtatcctgacccagaccaacaaagcagtgagctgctttaacatccagatg
tgtgtgggagccaccgggcataacattactgaaaagctgcacctgaatgctgagctgcag
ctggaccgacagaagccacgccagggccggcgggtgctgctgctgggctctcagcaggcg
agcaccaccctgagcctggacctgagcaggaggcacagccctatctgccacaccaccaag
gccttcctccgagatgaggctgacttccgggacaagctgagccccattgtgttcagcctc
aacgtctccctgcagcctgaggaggctggactggcccctgctctcctgctgcttggagat
actcatgtccaggagcagacccgcatcatcctggattgtggggaggaccacctgtgtgta
ccccagcttcagctcactggtgaaatgaggggctccccgctcctgattggggctgacagt
gtactaaagctgcagatggatgctgtcaacgaaggcgagggggcgtatgaggctgaactg
gtcgtgcacctgcccccaggtgcctactacatgcaggccctcagtgacattcaggggtat
gaaaggctcatctgtaaccagaagaaggagaatgagaccaagatggtactgtgtgagctg
ggcaaccccatgaagaaggatgcccggatacaaatcacaatgttgctgagtgtggagaat
ctagaagaggttggggagtacatgtccttccagctgcagatcaggagcaagaacagccag
aatccaaacagtgagatggtgctgttgaatgtgccagtctgggcggaggcccacgtggag
cttcgagggaactcctttccagcttccctggtggtaccagctgaggaaggcgacaggaag
acagaaagctcagacagctggggccccagagtggagcacacctatgagctccacaacaag
ggccctggtgctgtcagtggcctgcgcctcaacctgcagtttcccagccagtctcagcct
tctgacctgctctacatcctggatgtgcagccccagggggggctccagtgctcccctcag
ccttcccccaaaccactccagttggaccagaggctgcccacccccagccaaccccctgtt
taccctgagcatcacaagcgggagcgcagacaggccctccagccaggctcacagcagccc
tcagagctccaagaccccattctagtgaactgcgactcggcgccgtgtactgtagtgcag
tgtgagctacaggagatggcgcccgggcagcgggccatggtcaccgtgctggccttcctg
tggctgcccagcctccgccagaggccactggatcagtttgtcctgcagtctcacgcttgg
ttcaacgtatccgcccttccctatgcggtgcccgccctcagcctgccgagaggggaagca
ctagtgcagacgcagctccttcgtgtcttggaggagagggacgttcctatctggtggatt
ctggtaggcatgctgggtggtctgctgctgctcacactgctggtcctagccatgtggaag
gttggcttcttcaagcggaatcgccctcccctggaagaggaagatgaggaggagtga

KEGG   Loxodonta africana (African savanna elephant): 100660884
Entry
100660884         CDS       T04351                                 

Gene name
ITGA9
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100660884 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100660884 (ITGA9)
   04514 Cell adhesion molecules
    100660884 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660884 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100660884 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100660884 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100660884 (ITGA9)
   05414 Dilated cardiomyopathy
    100660884 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100660884 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100660884 (ITGA9)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100660884 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 100660884
NCBI-ProteinID: XP_023410567
LinkDB
Position
Unknown
AA seq 1172 aa
MGGPAARRGAGGLRALLLALVAAATPAGAYNLDPQRPVRFQGPDGSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSTSVKLPNPSWPSNECEKQPANHHSLTKPGFSLFPPGKNRGTSCGK
TCREDRDDEWMGVSLARQPKADGNVLACAHRWKNIYYETDHILPHGFCYVIPSNLQAKGR
TLIPCYEEYKKKYGEEHGSCQAGIAGFFTEVGIGSSGIFVILWLFSATITISVSASTSTT
SITTAIATAFITTTITSVTTITSITNTTTSIITITSVTAITSITAPTSITAITSITAPTS
ITAPTSITAITSITAPTSVTAITSIITITSITAPTSVTAPTSVTAPTSVTAPTSITAITS
ITAPTSVTAITSIITITSITAPTSVTAPTSYFKLNDEAIVNRRYTYLGYAVTAGHFSHPS
TTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNADGLSD
LLVGAPMFSEIRDEGQVTTYINRGNGALEEQVALTGDSAYNAHFGESIASLGDLDDDGFP
DVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNG
YPDVTVGAFMSDSVVLLRARPVITVDVSILLPGSINITAPQCHDGQQPVNCLNVTACFSF
HGKHVPGEIGLNYVLTADVSKKEKGQLPRVYFVLLGETMGQITEKLQLAHREETCHHYLA
HVKRRVQDVINPIVFEAAYSLGEHVTGGEEKELPALTPVLRWKKGQKIAQKNQTVFERNC
RSEDCAADLQLRGRLLLSSNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLEPDF
LKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEDVLTFIVTAQSGNVERSESLHDNALSLTV
PLMHEVDTSITGLMSPTSFVYGESVDTSSFVQLDDLECRFQRLNVTLQVYNAGPSTLPGS
SVSISFPSRLSSGGAEMLHIQEMMVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTK
SGRKVLDCEKPGISCLTVHCNLSTLAKEESRTIDVYMLLNTEILKRDSSSVIQFMTRAKV
KVDPALRVVEIADGNPEEMTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWK
MGFFRRRYKEIIEAEKNRKENEDSWDWVQKSQ
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgggcggcccggcggcgcggaggggcgccggggggctccgcgcgctgctcctggcgctg
gtggccgcggcgacccccgcgggcgcctacaacctagacccgcagcggcccgtgcgcttc
cagggccctgacggctccttcttcggctacgcggtgctggagcatttccacgacaacacg
cgctgggtccttgtgggcgcaccaaaggcggattcaaagtacagcacttcggtgaaactc
cctaacccctcgtggcccagtaacgaatgcgaaaagcagccagcaaaccatcactcctta
accaagcctgggttttctcttttccctccagggaagaatcggggcacatcctgtggaaag
acctgccgggaagaccgggatgatgagtggatgggggtgagcctggctaggcagcccaag
gctgatggcaatgtgctggcctgcgcccatcgctggaagaacatctactatgaaacagac
cacatcctgccgcacggcttctgctacgtcatcccgtccaacctccaggccaaaggcagg
acgctgatcccttgttatgaagagtataagaagaagtacggggaggaacatggctcctgt
caggctgggatcgcaggcttcttcaccgaggtgggtattggctcttcgggcatttttgtt
attttgtggctttttagtgccaccatcaccatctccgtctctgcctccacctccaccacc
tccattaccaccgctatcgccaccgcattcattaccaccaccattacctccgttaccacc
atcacctccattacgaacactaccacctccatcatcaccatcacctccgttaccgccatc
acctccattaccgcccccacctccattactgccatcacctccattaccgcccccacctcc
attactgcccccacctccattactgccatcacctccattacggcccccacctccgttacc
gccatcacctccatcatcaccatcacctccattactgcccccacctccgttactgccccc
acctccgttactgcccccacctccgttactgcccccacctccattactgccatcacctcc
attacggcccccacctccgttaccgccatcacctccatcatcaccatcacctccattact
gcccccacctccgttactgcccccacctcctatttcaaactgaacgatgaagcaatcgtg
aacaggcggtacacatacctgggctatgcagtgactgccggccacttctctcacccgtcc
accaccgatgtggtagggggtgctccacaggatgaaggcatcggaaaggtttatattttt
agagctgaccgacgatcaggcaccttaattaagatttttcaggcatcaggtaaaaagatg
ggctcttacttcggctcctccttatgtgcagttgacctgaatgcggacggcctctctgac
ctgctggtgggtgcccccatgttttctgagatcagggacgaggggcaggtcaccacctac
atcaacagaggaaacggagccctcgaggagcaggtggccctgaccggggacagcgcctac
aatgctcactttggggaaagcattgccagcctgggcgaccttgacgacgacgggttccca
gatgtggccattggcgcacccaaggaagatgacttcgcgggggcagtctatatctatcat
ggcgatgccggtgggatagtccctcagtactcaatgaaactgtctgggcagaagataaac
ccggtactgcggatgtttggtcagtccatatcaggaggcattgatatggatggaaatggc
tatcccgatgtaaccgttggagccttcatgtccgacagcgtggtccttctaagggcaaga
cccgtcattacggtggacgtctccatcctcctcccaggctccatcaacatcacggcacct
cagtgtcatgacggacagcagcctgtcaactgcctgaatgtcaccgcctgctttagcttc
cacggcaagcacgtgccaggagagatcggcctgaattatgttctgacggcggatgtgtcc
aaaaaggagaagggccagctgcccagggtctactttgtgttgctgggagagaccatgggt
cagatcacagagaagctgcagctggcccacagggaggagacgtgccatcactacttggcc
catgtgaagcggagagtccaggacgtcatcaatccaattgtgttcgaagcagcctacagc
ctcggcgagcatgtgactggaggggaggagaaagagctgccagccctgacaccagtgctt
cgctggaagaagggacagaagatcgcccagaagaatcagaccgtttttgaaaggaattgc
cgttccgaggactgtgctgcggacctgcagcttcggggtagactgttgctctccagcaac
cttggggacgatgcctatgatgccaatgtgtccttcaatgtttcccgggagctgttcttc
atcaacatgtggcagaaggaggagatgggcatttcctgtgagctgctggaaccggacttc
ctcaagtgcagtgtgggatttcctttcatgaggtcgaagtcaaagtatgaattcagcgtg
atctttgatacaagccacctgtctggagaagaggatgtccttacattcatcgttactgct
cagagtggcaacgtggagcgctccgagtctctgcacgacaacgccctctcgctgacggtg
ccgcttatgcacgaagtggacacgtccatcacgggacttatgtctccaacctcgtttgta
tatggcgagtctgtggacacatccagcttcgtccagctagatgacctggagtgtcgtttc
cagcgcctcaacgtcacccttcaggtctacaacgctgggccgagcaccctccctgggtca
tctgtcagcatctccttccccagtcgactgtcctccgggggtgcggagatgcttcacatc
caggagatgatggtgggccaagaaaagggaaactgctctttccagaaaaatccaacccca
tgcatcatccctcaagaacaagaaaatatcttccacacaatatttgcctttttcacaaag
tctggaagaaaagtcttggactgcgaaaaaccaggaatatcttgcctaacagtgcactgt
aaccttagcactctcgctaaagaagaaagtcgtacgatcgacgtttacatgctgctgaac
acagaaatactgaaaagggacagttcctctgtcatccagtttatgactcgagccaaggtg
aaggtggaccctgccctcagggtggtggaaatagccgatgggaacccagaggagatgacg
gtggtctttgaggccttgcacaacctggagccacgtggctacgtcgtgggctggatcatt
gccattagcctgctggtaggaatccttatcttcctgctgctggctgtcctgctctggaag
atgggcttctttcgccgaaggtacaaagaaattatcgaagctgagaagaaccggaaagag
aacgaagacagttgggactgggtccagaaaagccagtga

KEGG   Loxodonta africana (African savanna elephant): 100661035
Entry
100661035         CDS       T04351                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05145  Toxoplasmosis
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100661035 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100661035 (ITGA6)
   04514 Cell adhesion molecules
    100661035 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100661035 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661035 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100661035 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661035 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100661035 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100661035 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100661035 (ITGA6)
   05414 Dilated cardiomyopathy
    100661035 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100661035 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100661035 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100661035 (ITGA6)
   04515 Cell adhesion molecules [BR:lav04515]
    100661035 (ITGA6)
   04090 CD molecules [BR:lav04090]
    100661035 (ITGA6)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100661035 (ITGA6)
  Exosomal proteins of breast milk
   100661035 (ITGA6)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100661035 (ITGA6)
CD molecules [BR:lav04090]
 Proteins
  100661035 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 100661035
NCBI-ProteinID: XP_010601127
LinkDB
Position
Unknown
AA seq 1092 aa
MAAAGQLWLLYLSAGLLSLLCAAFNLDTREDYVIQKLGDPESLFGFSLAMHWQLQPEDKR
LLLVGAPQAKALPLQRANRTGGLYSCDITSQEPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GENNHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSTH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRGGEVGGAVYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGMGKVFIYHGSANGINTK
PTQVLKGRSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTVFRARPVINIQKTITVTPDK
IDLSKKMSCAAPSGICLKVKACFEYTAKPTGYNPSIVIVGTLEAEKERRKSGLSSRVQIR
NQGSEPKYSQQLILSRQKQKACMDETLWLQENIRDKLRPIPITASVEIQESGSRRRVNSL
PEIPPILNSNEPKTVHADVHFLKEGCGSDNVCNSNLKLEYKFCTREGSQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTNDGDDAHEAKLIATFPDTLTYSAYRELRSFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLASITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFSVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIGCEPPSEINFLKLKESHNSRK
KREIAEKQIDDRRKFSLFAERKYQTLNCSVNVKCVNIKCPLQGLDSKASVILRSRLWNST
FLEEYSKMNYLDILTRASIDVTAAAENIKLPNAGTQVRVTVFPSKTAAQYSGVSWWIILV
AILAGILMLGLLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIQDEKYNNDNLEKKQ
WIAKWTENESYS
NT seq 3279 nt   +upstreamnt  +downstreamnt
atggcggccgccgggcagctgtggctgctttacctgtcggcggggctcctttccctgctc
tgcgccgccttcaacttggacacccgcgaggactatgtgatccagaaactcggggacccc
gagagcctcttcggcttctcactggccatgcactggcagctgcagcccgaggacaagcgg
ctgttgctagtgggagccccccaggccaaagcccttccactgcagagggccaaccggaca
ggaggcttgtacagctgcgacatcacctcccaagagccatgcacaaggattgaatttgat
aacgatgctgacccttcgtcggaaagcaaggaagatcaatggatgggtgtcacagtccag
agccagggcccggggggcaaagttgtgacatgtgctcacagatatgaaaaaaggcaacat
gttaatacaaagcaggagtcccgagacatctttggaaggtgttacgtcctgagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgcgatggtcgtttgaga
ggccatgaaaaatttggttcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtgtttggagccccgggtacttacaactggaaagggattgttcgcgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagaataaccatgacgaaagtctagttcctgttcctgccaacagttatttaggcttt
tctctggactcagggaaaggtattgtttctaaagatgacatcacgtttgtatctggtgct
ccgagagccaatcacagcggagctgtggttctgttaaaaagggacatgaagtctacacat
cttctccctgagcacatatttgatggggaaggtctggcctcttcgtttggctatgacgtg
gcagtggtggacctcaacaaagatgggtggcaagatatagttattggagccccacagtat
tttgatagaggtggagaagttggaggtgcagtgtatgtctacattaaccagcaaggcagg
tggaataatgtcaagccaattcgtctcaatggaaccaaagattctatgtttggcattgca
gtcaaaaatattggcgatattaatcaagatggctatccagatattgcagttggagctcct
tatgatggtatgggaaaggtttttatctatcatgggtccgcaaatggaataaataccaaa
ccaacacaggttctcaagggcagatcaccttactttggatattcaattgctggaaatatg
gaccttgatagaaattcctaccctgacgtcgctgttggttccctttcagattcagtaact
gttttcagagctcgtcctgtgattaatattcagaaaaccatcacagtaacacctgacaaa
attgatctcagcaagaaaatgtcttgtgcagcgcctagtgggatatgcctcaaggttaaa
gcctgttttgagtatactgctaaacccactggttataatccttccatagtaattgtgggc
acactcgaagctgaaaaggaaagaaggaaatctgggctgtcgtcaagagttcagattcga
aaccaaggttctgagcccaagtactctcagcaactcattctgagtaggcagaagcagaag
gcgtgcatggatgagaccctctggctgcaggaaaatatcagagataaactgcgtcccatt
cccataactgcttcagtagagatccaagagtctggctctcggagacgagtaaattcactt
ccagaaattcctccaattttgaattcaaatgagcctaagacagtccacgcagacgtacac
ttcttaaaagaagggtgtggaagcgacaatgtgtgtaatagcaaccttaaactggaatat
aagttctgtacccgagaaggaagtcaagacaaattttcttatttaccaattcaaaaaggt
gtaccagagctagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaatccaaggaatcccacaaacgatggtgatgacgctcatgaggctaaactc
atcgcaacatttccggacaccctgacttattctgcatatagagaactgaggtctttccct
gagaaacagctgagttgtgttgccaaccaaaatggctcgcaagcagactgtgagcttgga
aatccttttaaaagaaattccaacgtgactttttatttgattttaagtacgacagaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaagat
aatttggcctcaattacagctaaagcaaaagtggttattgaactgcttttatcggtctct
ggagttgctaaaccttctcaggtgtattttggaggtacagttgtgggtgagcaagctatg
aaatctgaagacgaagtgggaagtttaatagagtatgagttcagcgtaattaacttaggc
aaacctcttaaaaacctcggtacagcaaccctgaatattcagtggccaaaagaaatcagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaaaataggc
tgtgagccaccaagtgaaataaacttcctgaagctaaaggaatctcacaactcaagaaag
aaacgggaaattgccgaaaaacagatagatgatagaaggaaattttctttatttgccgaa
aggaaatatcagacccttaactgcagtgtgaacgtgaagtgtgtgaacataaagtgcccg
ctgcaagggctggacagcaaggcctctgtgattctgcgctcgaggttatggaacagcacg
tttctagaggaatattctaaaatgaactacttggacattctcacgcgggcttccattgat
gtgactgctgccgcagagaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtatttccctccaagactgcagctcagtattcaggagtctcttggtggatcatcctagtg
gctattcttgctggaattttgatgcttggtctattagtgtttttactatggaagtgtgga
ttctttaaacgctcgaggtacgatgatagcgttccccgataccatgctgtaaggatccgt
aaagaagagcgagagatccaagatgaaaaatataataatgataaccttgaaaaaaagcag
tggatcgcaaagtggactgaaaatgaaagctactcctag

KEGG   Loxodonta africana (African savanna elephant): 100665471
Entry
100665471         CDS       T04351                                 

Gene name
ITGA7
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-7
  KO
K06583  integrin alpha 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100665471 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100665471 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100665471 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100665471 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100665471 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100665471 (ITGA7)
   05414 Dilated cardiomyopathy
    100665471 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100665471 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100665471 (ITGA7)
   04515 Cell adhesion molecules [BR:lav04515]
    100665471 (ITGA7)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100665471 (ITGA7)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100665471 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 DUF3488 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100665471
NCBI-ProteinID: XP_003405154
LinkDB
Position
Unknown
AA seq 1141 aa
MAGTRGHDPWGASGLFYLLGSLLAGMFCPGAVAFNLDVMGALRKEGESGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGVDVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHDQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCVQGSADLAY
LDDGPYEAGGEKEQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVVLSGERLTSGFGYSLAVADLNNDGWPDLVVGAPYFFERQEELGGAVY
VYMNQGGHWADVSPLRLCGSPDSMFGVSVAILGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVLTPSQVLEGEAVGIKSFGYSLSGGLDMDGNHYPDLLVGSLADTAVLFRARPVLH
VSHEVFIAPRTIDLEQPNCPGGHSVCVDLRVCFSYIAAPSSYSPIVALNYMIDGDTDRRL
RGQVPRVTFLSRNPDDPKHQASGTVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYS
LQXPRLRRQAPGQGLPQXGPILNVHQPSTQRAEIHFLKQGCGEDKICQSNLQLVQARFCS
RVSDTEFQPLPMDADGMTALFALSGQPVIGLELKVTNLPSDPAQPQADGDDAHEALLLVT
LPASLDYSGVRALDPAEKPLCLSNENASHVVCELGNPMKRGAQVTFYLILSTSGITIETT
ELDVELLLATISEQELHPVSLRARVFIELPLSITGVAIPQQLFFSGVVRGESAMRSERDV
GSKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPVRVELEGGQGPGQKGFCS
PRPNILHLDVYSWDRRRRELGQPEQQEPREQPEPSASWWPVSSAEKMKNITLDCARGTAN
CIVFSCPLYSFDRVAVLRVWGRLWNSTFLEEYSTVKSLEVIVRANITVKSSIKNLLLKDA
STVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVP
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGRPELGPDRHPVPAT
A
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggccgggacacggggccacgatccttggggggcctctgggcttttctaccttcttggc
tctctgcttgccggaatgttctgccccggggctgttgccttcaatctggacgtgatgggc
gccctgcgcaaggagggcgagtcgggtagtctcttcggcttctctgtggccctgcaccga
cagttgcagccccgaccccagagctggctgttggtgggtgctcctcaggccctggctctg
cctgggcagcaggcaaatcgcactggaggcctcttcgcctgccccttgagcctggaggag
accgactgctacagagtggacatcgaccagggagttgatgtgcaaaaggagagcaaggag
aaccagtggctgggagtcagtgttcggagccaggggccagggggcaagattgttacctgt
gcacatcgatatgaggcacggcagcgagtggaccagatcctggagacgcgcgatgtgatc
ggtcgctgctttgtgctcagccaggacctcgccatccgtgatgagctggatggtggggag
tggaagttctgtgaggggcgcccccagggccacgaccaatttgggttctgccagcagggc
acagccgccgccttctcccccgacagccactatctcctctttggggccccgggaacttat
aactggaagggcacggccagggtggagctctgtgtgcagggctcagcggacctggcatac
ctggacgacgggccctacgaggcggggggcgagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttggtttctccattgactcggggaaggggctggtgcgtgca
gaggagctgagctttgtcgcaggggcgcctcgtgccaaccacaagggtgctgtggtcatt
ctgcgcaaggacagtgccagccgcctggtacctgaagtcgtattgtctggggagcgcctg
acctctggctttggctattcactggctgtggccgatctcaacaatgatggctggccagac
ctggtagtgggtgccccctacttctttgagcgccaagaagagctgggtggtgctgtgtat
gtgtacatgaaccagggtggtcactgggctgatgtctcccctcttcgactctgcggctcc
cctgactccatgtttggagtcagtgtggctatcctgggggacctcaaccaagatggcttc
ccagatatcgctgtgggtgctccctttgatggtgatggaaaagtctttatctaccacggg
agcagcctgggggttgttcttacaccttcacaggtgctggagggcgaggctgtgggcatc
aagagcttcggctactccctgtctggcggcctggatatggacgggaatcattaccccgat
ctgctggtgggctccctggctgacactgctgtcctctttagggccagacctgtcctccat
gtctcccatgaggtcttcattgctcctcgtaccatcgacctagaacagcccaactgtcct
ggtggccactcagtctgtgtggacctaagggtatgtttcagctacatcgcagcccccagc
agctacagccctattgtggccctgaattacatgatagatggagacacagaccggaggctc
cggggccaggtcccacgggtgaccttcctgagtcgtaatccagatgaccccaaacaccag
gcctcgggcaccgtgtggctgaagcaccagcatgaccgagtctgtggagacaccatgttc
cagctgcaggagaatgtcaaagataagcttcgggccattgtggtgacgctgtcctatagt
ctccagnaccctcggctccggcgacaggctcctggccaggggcttccccagnntggcccc
atcctcaatgtccaccagcccagcacccagcgggcagagatccactttctgaagcaaggc
tgtggtgaagacaagatctgccagagcaacctgcagctagtccaggctcgcttctgttcc
cgggtcagcgacacggagttccagcctctgcccatggatgctgatgggatgacagccctg
tttgcactgagtgggcagccagtcatcggcctggagctgaaggtcaccaacctgccctcg
gacccagcccagccccaggctgatggggacgatgctcacgaggccctgctcctggtcact
ctccctgcctctttggactactcaggagtccgggccttggaccctgccgagaagccactc
tgcttgtccaatgagaatgcttcccatgtcgtgtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctaccttatacttagcacctcagggatcaccattgagaccaca
gagctggacgtggagctgctgctggccacgatcagcgagcaggagctgcatccagtctct
cttcgggcccgggtcttcattgagctgcccctgtccatcactggggtggccattccccag
caactcttcttctccggtgtggtgaggggcgagagtgccatgaggtctgagcgtgatgtg
ggcagcaaggtcaagtatgaggtcacggtctccaaccaaggccagtcgctcaacactctg
ggctctgccttcctcaacattatgtggccccacgagattgccaatgggaagtggctgctg
taccctgtacgggtggagctggagggcgggcaggggcccgggcagaaggggttctgttcc
ccgaggcccaatatcctccacctggatgtgtacagctgggacaggaggcggcgggagctg
gggcagcctgagcagcaggagccacgtgagcagccggagcctagcgcatcctggtggcca
gtgtcctctgctgagaagatgaaaaacatcaccctggactgcgcccgaggcacagctaac
tgcatagtgttcagctgcccgctctacagctttgaccgcgtggctgtgctgcgagtctgg
ggccgcctctggaacagcaccttcctggaggagtactcaactgtgaaatccctggaagtg
attgtccgggccaacatcacggtgaagtcctccatcaagaacttgctgcttaaagatgcc
tccacagtgattccagtgatggtgtatttggacccgatggccgtggtggcagaaggagtc
ccctggtgggtcatcctcttggctgtactggctgggctgttggtgctggcactgctggtg
ctgctgatgtggaagatgggattcttcaagcgggctcggtaccctgaggcaacagtgccc
cagtaccatgcggtgaagatcccacgggaagatcggcagcagttcaaggaggagaagaca
ggcaccatcctgaggaacaactggggcagcccccggagggaaggccctgatgcacacccc
atcctggctgcggatgggcgccctgagctgggccctgacaggcatcctgtgccagccact
gcctag

KEGG   Loxodonta africana (African savanna elephant): 100667832
Entry
100667832         CDS       T04351                                 

Gene name
ITGA10
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-10
  KO
K06586  integrin alpha 10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100667832 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100667832 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100667832 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100667832 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100667832 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100667832 (ITGA10)
   05414 Dilated cardiomyopathy
    100667832 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100667832 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100667832 (ITGA10)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100667832 (ITGA10)
SSDB
Motif
Pfam: PEX11 Integrin_alpha2 VWA FG-GAP VWA_2 VCBS
Other DBs
NCBI-GeneID: 100667832
NCBI-ProteinID: XP_023396801
LinkDB
Position
Unknown
AA seq 1348 aa
MDAWVRFSAQSQARERLCRAAQYACCLLGHALQKHGASPELQKQIQQLEGHLSLGRKLLR
LGNSANALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA
QRSFRYYLFSLIMNLSRDAYEIRLLMEQESAACSRRLKGSGGGAPEGIETGGPGLSGTPG
GGLPQLALKFRLQILLLAQVSAPHLTWMCITHAYSQGHPRLNLDTVSYNMLRVDGDGCWW
VPPGMGLQVTGEGMFIAALGGSLNAPCAKGHLGDYPLGNSSHPAVNMHLGMSLLETDGVG
GFMACAPLWSRACGSSVFSSGICACVDDSFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIY
PWSEVQTFLRRLVRRLFIDPEQIQVGLVQYGESTVHEWSLGDFRTKEEVVRAARNLSRRE
GRETKTAQAIMVACTEGFSQSRGGRPEAARLLVVVTDGESHDGEELPEALKACEAGRVTR
YGIAVLGHYLRRQRDPSSFLQEIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEG
SHGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWVEKGHHLFPPRTALEDE
FPPALQNHAAYLGYSVSSMLLQGGRRLFISGAPRFKHRGKVIAFQLKKDGAVRVAQSLQG
EQIGSYFGSELCPLDTDGDGTTDVLLVAAPMFLGPLNKETGRVYVYLVGQQPLLMLRGKL
QPEPPQDARFGFAMSALPDLNQDGFADVAVGAPLEDGHRGALYLYHGTQSGVRSHPAQRI
AAVSMPQALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIIHLTPSLTVTPPAI
SVVQRNCRRRGQEAACLTADLCFQVTSHTPGRWTRQFYMRFTASLDEWTAGARAAFDGTG
QRMSPRRLRLSVGNVTCEQLHFHVLDASDYLRPVALTVTFALDNTTKPGPVLDEGSPTSI
RKLVPFSKDCGPDNECVTDLVLRANMDIRGSRKAPFVVRGGRRKVLVSATLENRKENAYN
TSLSLSFSRNLHLASLTPQRDSPVKVECAAPSSHAQLCSVGHPVFQSGAKVTFLLEFEFS
CSALLSQVLVRLIATSNSLETDGTLQDNTAQASVYIQYEPHLLFSSESTLHRYEVHPYGT
LPVGSGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCTVQNL
TEPPQAPVDPEELQHTSRLNESNTRCQVVRCHLGRLAKGTEISIGLLRLVHNEFFRRAKF
KSLTVVSTFEMGTEEGSVLQLTEASRWSESLLEVIQTHPVLISLWILIGSILGGLLLLAL
LVFCLWKLGFFARKKIPEEEKREEKLEQ
NT seq 4047 nt   +upstreamnt  +downstreamnt
atggacgcctgggtccgcttcagcgctcagagccaggcccgggagcggctgtgtagggct
gcccagtatgcttgctgtcttcttggtcatgcactgcagaaacatggggccagtcctgag
ttacagaaacagattcaacaattggagggtcatttgagccttggaagaaagcttctacgt
ctgggtaactcagcaaatgccctcgagtcagccaaacgagctgtgcacctctcagatgtt
gtactgagattctgcatcactgttagtcacctcaatagagccttgtacttcgcctgtgat
aatgtcctatgggctggaaagtctggattggctccccgtgtggatcaggagaagtgggcc
cagcgttcattcaggtactatctcttttccctcatcatgaatttgagccgagatgcctat
gagattcgcctactaatggaacaggagtctgcagcttgtagccggcgactgaagggttcc
gggggaggagccccagaaggaattgaaactgggggtcctgggctatcagggactccagga
ggaggcctgccccaactggctctgaagtttcggctgcaaatcctgctcctagctcaggtc
tctgctccccatttaacctggatgtgcatcacccacgcctattcccagggccacccgagg
ctgaatttggatacagtgtcttacaacatgttgcgggtggacggcgatggatgctggtgg
gtgccccctgggatgggccttcaggtgaccggagaggggatgtttatcgctgccctgggg
ggatccctcaatgccccttgtgccaagggccacttaggtgactatccactgggaaattca
tctcatcctgctgtgaacatgcacctggggatgtctctactagagactgatggtgttggg
ggattcatggcctgcgctcctctctggtctcgtgcttgtggctcctctgtcttcagttct
gggatatgtgcctgtgtagatgattcgttcaggccccaggggagcctggcacccacagcc
caacgctgccccacatacatggatgttgtcatcgtcttggatggctccaacagcatctac
ccttggtctgaggttcagactttcctacgaagactggtcaggagactgtttattgacccg
gagcagatacaggtgggactggtacagtatggggagagcactgtacatgagtggtccctg
ggagatttccgaaccaaggaagaagtggtgagagcagcaaggaacctgagtcgaagggag
ggccgagaaacaaagactgcccaagcaataatggtggcctgtacagaagggttcagtcag
tcccgtggggggcgaccagaggcagccaggctactagtggttgtcactgatggagaatca
cacgatggggaggagcttcccgaagcactgaaagcctgtgaggctggaagagtgacacgc
tatgggattgcggtcctcggtcactacctccggcggcagcgagatcccagctctttcctg
caggaaatccgaactatcgccagtgatccagatgagcgatttttcttcaatgtcacagat
gaggctgcactaactgacattgtggatgcactaggagaccggatttttggccttgagggg
tcccatggagagaatgaaagctcctttgggctggaaatgtctcagattggtttctccact
catcggctgaaggatgggattctctttgggatggtgggggcctatgactgggggggctca
gtgctatgggttgaaaaaggtcaccaccttttccccccacgaacggccctggaagatgaa
ttcccccctgcgttgcagaaccatgcagcctacctcggttactctgtttcctccatgctc
ttgcaaggtggacgccgcctgtttatctcaggggctcctcgatttaaacatcgaggaaag
gtcatcgctttccagcttaagaaagatggggctgtgagggtcgcccagagcctccagggg
gagcagatcggctcatactttggtagtgagctctgcccattggatacagatggagatgga
acaactgatgtcttacttgttgctgcccccatgttcctgggacccctgaacaaggagaca
ggacgtgtttatgtgtatctggtgggccagcagcccttactgatgctccgggggaaactt
cagccagaaccccctcaggatgctcggtttggctttgccatgagtgcccttcctgacctg
aaccaagatggcttcgctgatgtggctgtgggggcgcccctggaggatggacaccggggt
gcactgtacctgtatcatgggacccagagtggagtcaggtcccatcctgcacagcggatt
gctgctgtctccatgccacaggccctcagctattttggcagaagtgtggatggccggcta
gatctggatggagatgatttggtagatgttgctgtgggtgcccagggggcagccatcctg
ctcagctcccgacctatcatccacttgaccccttcactgactgtgaccccacctgccatc
agtgtggttcagcggaactgcaggcgacgtggccaggaggcagcctgcctgaccgcggat
ctttgcttccaagtaacctcccacactcctggccgctggactcgtcaattctatatgcgg
ttcacagcatcactggatgagtggacggctggggcacgtgcagcatttgatggtactggc
cagaggatgtcccctcggaggctccggctcagtgtggggaatgtcacttgtgagcagctg
cacttccatgtactggatgcatcggattatcttcgaccagtggccttgactgtgaccttt
gccttggacaacaccacaaagccagggcctgtgctggatgagggctcacccacctctata
cgaaagctggtccccttctcgaaggattgcggccctgacaatgaatgtgtcacagacctg
gtacttcgagctaatatggacatcagaggctccaggaaggccccgtttgtggttcgaggt
ggccgacggaaagtgctagtgtcagcaactctggagaacaggaaggaaaacgcctacaac
actagtctgagtctcagtttttccagaaacctccacctggctagccttactcctcagagg
gacagcccagtgaaggtggaatgtgcagccccttcctctcatgcccagctttgcagcgtg
gggcaccctgtcttccagagtggagccaaggtgacctttctgctagagtttgagtttagc
tgttctgccctcctgagccaggtcctcgtgaggctgatcgccaccagcaatagcctggag
acagatgggacccttcaagataatacagcccaggcctcagtctacatccagtatgagcct
cacctcctgttctctagtgagtccaccctgcaccggtatgaggttcacccatatgggacc
cttccagtgggttctggccccgaattcaaaaccactcttagggtgcagaacctcggctgc
tatgtggtcagtggcctcatcatctcagccctccttcccgctgtggcccatgggggcaat
tacttcctgtcattgtctcaagtcatcaccaacaatgcaagctgcacagtgcagaacctg
actgagcccccacaagcccctgtggacccagaggagcttcagcacacaagtagactgaat
gagagcaatacccggtgtcaggtcgtgaggtgtcaccttggacggctagcgaagggaact
gaaatctccattggactactgaggctggttcacaatgaatttttccggagagccaagttc
aagtctctgacagtggtcagcacctttgagatgggaactgaggagggcagtgtcctacag
ctgactgaagcctcccgttggagcgagagcctcttggaggtgattcaaacccaccctgtc
ctcatctccctgtggattctcattggcagtatcctgggaggtctgctcctgcttgccctc
cttgtcttctgcctttggaagcttggcttctttgcccgtaagaaaatccccgaagaagag
aaaagagaagagaagttggagcaatga

KEGG   Loxodonta africana (African savanna elephant): 100670461
Entry
100670461         CDS       T04351                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11 isoform X1
  KO
K06587  integrin alpha 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100670461 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100670461 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670461 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100670461 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100670461 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100670461 (ITGA11)
   05414 Dilated cardiomyopathy
    100670461 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100670461 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100670461 (ITGA11)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100670461 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Ku_N
Other DBs
NCBI-GeneID: 100670461
NCBI-ProteinID: XP_010596362
LinkDB
Position
Unknown
AA seq 1241 aa
MDLPRGLVVAWALSLWPGFTDTFNMDTRRPRVISGPSTAFFGYTVQQHEISGKKWLVVGA
PLETNGHQKTGDVYKCPVIHGNCTKLNLAHNNNCCCGFQCDAISLGRGRSPRCQRHEAGR
HWKAFLSWGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCS
RVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQ
VGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTALGIEFARSEAFQKGGRK
GAKKVMIVITDGESHDSPDLKKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYI
ASDPDEKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGI
LLGAVGAYDWNGAVLKETSGGKVIPHRESYLKEFPEELKNHGAYLGYTVTSVVSSRQGRV
YVAGAPRFNHTGKVILFTMHNNQTLTIHQALRGEQIGSYYGSEITSVDIDGDGVTDILLV
GAPMYFSEGRERGKVYIYNLRQSQFVYNGTLKDSHSYQNARFGASIASVRDLNQDSYNDV
VVGAPLEDNHGGVIYIFHGFQGSLLKKPKQRISASELAPGLQYFGCSIHGQLDLNEDGLV
DLAVGALGNAVILWSRPVLQINASLHFEPPKINIFHRDCKRSGRDATCLVAFLCFTPVFL
APYFQMETVGLKYNATMDERRYTPRAHLDEGGDRYTHRSVLLSSGQEHCERISFHVLDTA
DYVKPVTFSVEYALEAADHGPMLDDGWPTTLRVSVPFWNGCNEDEHCVPDLVLDARSDLP
TAMEYCQRVLRKPVQDCSAYTLSFDTTVFIIESTRRRVAVEAMLENRGENAYSTALNISQ
SANLQFASLIQKDDFDGSIECVNEERRFHKKVCNVSYPFFRAKAKVSFRLDFEFSKSVFL
HHLEIQLAVGSDSDEQESTKEDNTALLRFHLKYEADILFTRRTSLSHYEVKSNSSLERYD
GMGPPFNSTFKIQNLGLFPIHGVMMKITVPIATRGGSRLLMLKDVLTDQGNVSCNVWGNS
TEYRRTPAEEDLSHAPQLNHSNSDVVSINCNVRLAPNQEINFHLLGNLWLTSLKALKYKS
MKITVHAALQRQFHSPFIFREEDPSRQIVFEISKQEDMEIPIWIILGSTLGGLLLLALLV
LALWKVKTSKIGLTRAWEMSEERLEYGAKPRVRAAFLSWEL
NT seq 3726 nt   +upstreamnt  +downstreamnt
atggacctgcccaggggccttgtggtggcctgggcgctcagcctgtggccagggttcaca
gacaccttcaacatggacaccaggaggccccgggtcatctccggccccagtaccgccttc
tttggctacacggtgcagcagcatgagatcagtggcaagaagtggctggttgtgggcgcc
ccgttggaaacaaacggccaccagaagacaggagatgtgtacaagtgtccggtgatccac
gggaactgcaccaagctcaacctggcacacaacaacaactgctgctgtggtttccaatgt
gacgccatttcccttggaagagggaggagccccagatgtcagagacatgaagctggaaga
cactggaaagcgttcctgagctggggaagggtcaccctgtccaacgtgtccgagcggaag
gacaacatgcgcctcggcctgagcctcgccaccaaccccaaggacaacagcttcctggcc
tgcagtcccctctggtcccacgagtgtggaagctcctactataccacgggaatgtgttcg
cgggtcaactccaacttcaggttctccaagaccgtggccccagccctccaaaggtgccag
acctacatggacatcgtcattgtcctggatggttctaacagcatctacccctgggtggag
gttcagcacttcctcatcaacatcctgaagaaattctacatcgggcctgggcagatccag
gttggagttgttcagtatggagaagacgtggtgcatgagtttcacctcaatgactatagg
tctgtaaaggacgtggtagaagctgccagccacattgagcagagaggaggaacagagact
cggacagcacttggcatagaatttgctcgttcagaggctttccagaaaggtggaaggaaa
ggggccaagaaggtgatgattgtcatcacagatggggagtctcacgacagccctgacctg
aagaaggtgatccagcaaagcgagagagacaatgtcaccagatacgctgtggccgtcctt
ggctactacaaccgcagaggcatcaacccagaaacttttctaaatgaaatcaaatacatc
gccagcgaccctgatgaaaagcacttcttcaatgtcaccgatgaggcggccctgaaggac
attgtcgatgccctgggggacaggatcttcagcctggaaggcaccaacaagaatgaaaca
tcctttggactagaaatgtcacagacgggcttctcctcacacgtggtggaggacgggatt
ctgctgggagctgtgggcgcctatgactggaacggagcggtgctaaaggagaccagtggc
gggaaggtcattcctcaccgtgagtcctacctgaaggagttccctgaggagctcaagaac
cacggtgcctacctggggtacacagtcacatcggtcgtgtcctccaggcaggggcgggta
tacgtggccggagcgccccggttcaaccacacgggcaaagtcatcctgttcaccatgcac
aacaaccagaccctcaccatccaccaggctctgcggggcgagcagataggctcttactat
gggagtgagatcacctcagtggacattgacggcgatggtgtgaccgacatcctgctggtg
ggcgcacccatgtacttcagcgagggccgggagcggggcaaggtgtacatctacaacctg
agacagagtcagtttgtctataatggaacactgaaggattcccacagttaccagaatgcc
cgattcggggcctccattgcctcggttcgagacctgaatcaggattcctacaacgacgtg
gtggtgggagcccctttggaggacaaccatggaggagtcatctacatcttccatggcttc
caaggcagcctcctaaagaagcctaagcagagaatctcggcctccgagctagctccaggc
ctccagtattttggctgcagcatccacgggcaactggacctcaatgaggatgggcttgtg
gacctggcagtgggtgcccttggcaacgccgtgatcttgtggtcccgccctgtgctgcag
atcaatgccagcctccactttgagccacccaagatcaacatcttccacagggactgtaaa
cgcagtggcagggacgccacctgcctggttgccttcctctgcttcacgcctgtcttcctg
gcaccctatttccaaatggaaactgttggcctcaagtacaacgccaccatggacgagaga
cggtacacaccacgggcccacctggacgagggcggggaccgatatacccacaggtctgtc
ctgctctcctctggccaagagcactgtgagcggatcagcttccacgtcctggataccgct
gactacgtgaaaccagtaaccttctcagtagagtatgccctggaggccgccgaccacgga
cccatgctggacgacggctggcccactaccctcagagtctcggtgcccttctggaatggc
tgcaatgaggatgagcactgtgtccccgatctcgtgttggatgctcggagcgacctgccc
acagccatggagtactgccagagggtgctgcggaagcctgtgcaggactgctcggcctac
acgctgtcctttgacaccacggtcttcatcatcgagagcacgcgccgccgggtggcagtg
gaggccatgctggagaacaggggcgagaacgcctacagcacagccctgaacatttcacag
tcagcaaacctgcagttcgccagcttgatccagaaggacgactttgatggcagcatcgag
tgcgtgaacgaggaacggagattccacaagaaagtctgcaatgtcagctaccccttcttc
cgggccaaggccaaggtgtcattccgtctagattttgagttcagcaaatctgtctttctg
caccatctggagatccagcttgctgtgggcagtgacagtgacgagcaggagagcaccaag
gaagacaacacggccctcctgcgtttccacctcaaatatgaggccgacatcctcttcaca
aggcgcaccagtctgagccactacgaggtcaagtccaacagctcacttgaaagatatgat
ggcatgggccctcccttcaacagcaccttcaagatccaaaacttgggcttgttccccatc
cacggggtgatgatgaagatcaccgttcccatcgccaccaggggcggcagccgcttgctg
atgctgaaggacgtcctcaccgaccagggaaacgtgtcctgcaatgtctgggggaacagc
actgagtatcggcgcaccccggcagaggaggacttgagtcacgccccacagctgaatcac
agcaactctgatgtcgtctccatcaactgcaacgtgaggctggcccctaaccaggaaatc
aatttccacctgctggggaacctgtggttgacgtccctaaaagcactcaagtacaagtcc
atgaaaataacggtccacgcggccctgcagcggcagttccacagtcccttcatcttccgt
gaggaggaccccagccgccagatcgtgtttgagatctcaaagcaagaagacatggagatc
cccatctggatcattctgggcagcacactggggggcctcctgctcctggccctactggtc
ttggcactgtggaaggtaaaaacgtccaagattggcctaacgcgcgcctgggagatgagt
gaagaaagacttgaatatggagcaaagcctcgtgttagagcagcgtttctctcctgggag
ctttaa

KEGG   Loxodonta africana (African savanna elephant): 100671252
Entry
100671252         CDS       T04351                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04810  Regulation of actin cytoskeleton
lav04919  Thyroid hormone signaling pathway
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100671252 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100671252 (ITGAV)
   04514 Cell adhesion molecules
    100671252 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100671252 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100671252 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671252 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100671252 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671252 (ITGAV)
   05205 Proteoglycans in cancer
    100671252 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100671252 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100671252 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    100671252 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100671252 (ITGAV)
   05414 Dilated cardiomyopathy
    100671252 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100671252 (ITGAV)
   05165 Human papillomavirus infection
    100671252 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100671252 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100671252 (ITGAV)
   04515 Cell adhesion molecules [BR:lav04515]
    100671252 (ITGAV)
   04090 CD molecules [BR:lav04090]
    100671252 (ITGAV)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100671252 (ITGAV)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100671252 (ITGAV)
  Exosomal proteins of epithelial cells
   100671252 (ITGAV)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100671252 (ITGAV)
CD molecules [BR:lav04090]
 Proteins
  100671252 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC Collectrin
Other DBs
NCBI-GeneID: 100671252
NCBI-ProteinID: XP_010601079
LinkDB
Position
Unknown
AA seq 1048 aa
MASQSRRRWFLCLRRLLFLLPGLLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSNRRCQPIEFDATGNRDYAKNDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGYNDIAIAAPYGGEDKKGVVYIFNGRSTGLHVVPSQI
LEGQWAARSMPPSFGYSMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVY
PSILNQDNKTCPLPGTSLKVSCFNVRFCLKADGKGALPRMLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRMAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPMVSYKADLAVLAAVEIRGVSSP
DHIFLPIPNWELKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLSLQWPYKYNNNTLLY
ILQYDIDGPMNCTSDMEINPLRIKVSTSQTTEKNDTIAGQGDRNHLITKRDLTLSEGDVH
TLGCGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVLVMYRMGF
FKRVRPPQEEQEREQLQPQENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctcagtcgcgaaggcggtggttcctctgccttcgtcgtctcctgttccttctc
cccggacttttactgcctctttgcggcgccttcaacctagatgtggacagtcctgctgag
tactctggccccgagggaagttactttggtttcgcggtggattttttcgtgcccagcgcg
tcttctaggatgtttcttctggtgggagctcccaaagcaaacactactcagcctgggatt
gtagaaggagggcaagtcctcaaatgtgactggtcttctaaccgccggtgccagccaatt
gaatttgacgcaacaggcaacagagattatgccaagaatgatccattggagtttaagtcc
caccagtggtttggagcatctgtgaggtcaaagcaggataaaattttggcctgtgcccca
ctgtaccactggaggactgaaatgaaacaggagagagagcctgttggaacatgcttcctg
caggatggaacaaagactgttgagtatgctccatgcagatcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggaggtcctggtagcttttattggcaaggtcagctcatttcagatcaagtggcagaa
attgtatctaaatatgaccccaaagtttatagcatcaagtataataaccagttagcaact
cggactgcacaagctatttttgatgacagttatttgggttactcagtggctgttggagat
ttcaatggtgatggcatagacgattttgtttcaggagttccacgagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaacatgtcttccttacataattttactggtgag
cagatggctgcatatttcggattttccgttgctgccactgacattaatggggatgactat
gcagatgtgtttattggagcacccctcttcatggatcgtggctctgatggcaaactccaa
gaggtgggtcaggtctcagtgtctctgcaaagagcttcaggagacttccagacaacaaag
ctgaatgggtttgaggtctttgcgaggttcggcagcgctatagcacctttgggagatctg
gaccaggatggctacaatgatattgcaattgctgctccatatggaggtgaagataaaaaa
ggagttgtttatatcttcaatggaagatctacaggcttgcatgtggtaccatctcagatc
cttgaagggcagtgggctgctcggagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacagaaatggatatccagatttgattgtaggagcttttggtgtggac
cgagctgtcttatacagggccagaccagttatcactgtaaacgctggccttgaagtatac
cctagcattttaaatcaagataataaaacctgcccactgcctggcacatctctcaaagtt
tcctgttttaatgtcagattctgcttaaaggctgatggcaaaggagcacttcccaggatg
cttaatttccaggtggagcttcttttggataaactcaagcaaaagggggcaattcggcga
gcactgtttctccataacaggtccccaggtcactccaagaacatgaccatttccaggggg
ggacagatgcagtgtgaggaactgatagcatatttgcgggatgaatctgaattcagggac
aagctcactccaattactatttttatggagtatcggttagattatcgaatggctgctgat
acaacaggcttgcaacctattcttaaccagttcactcctgccaatattagtcgacaggct
catattctacttgactgtggtgaagacaatgtttgtaaacccaagctagaagtttctgta
gatagtgatcaaaagaagatctatattggggacgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggcgcctatgaagctgagctcattgtctccattccaccgcaa
gctgatttcattggggttgtccgcaacagtgaagccttagcaagactttcctgtgcattt
aaaacagaaaaccaaacccgccaggtggtttgtgaccttggaaatccgatgaaggctgga
actcaacttttagctggtcttcggttcagtgtgcaccaacagtcagagatggatacttct
gtgaaatttgatctgcagatccaaagctccaatctttttgacaaagtaagcccaatggta
tcttacaaagctgatcttgctgttttagctgctgttgagataagaggagtctcaagtcct
gatcatatctttcttccaattccaaattgggagctcaaggagaaccctgagactgaagaa
gatgttgggccagttgttcagcacatctatgagctgagaaacaatggcccaagttcattc
agcaaggcaatgctaagtcttcagtggccttataaatacaataataacactttgttgtac
atccttcaatatgatattgatgggccaatgaactgcacttcggatatggagattaaccct
ttgagaattaaggtctcaacttcacaaacaactgagaagaatgacacaattgctgggcaa
ggtgaccggaaccatcttatcactaagcgggatctcaccctcagtgaaggggatgttcac
actttgggctgtggaatcgctgaatgcttgaagattgtctgccaggttgggcgactagat
agaggaaagagtgctatcctgtacgtgaagtctctcctgtggaccgagacctttatgaat
aaggaaaaccagaatcactcatattccctgaagtcatctgcatcatttaatgtcatagag
tttccttataagaaccttccaattgaggatatcttcaattccacattagttaccactaat
gtcacctgggggattcagccagcacctatgcctgtgcctgtgtgggtgatcattttagca
gttctagcaggattgttattactggctgttctggtgcttgtaatgtacaggatgggcttt
tttaaacgtgttcggccacctcaagaagaacaagaaagggaacagcttcaaccgcaagaa
aatggcgaaggaaactctgaaacttaa

KEGG   Loxodonta africana (African savanna elephant): 100671578
Entry
100671578         CDS       T04351                                 

Gene name
ITGA3
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100671578 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100671578 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100671578 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671578 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100671578 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671578 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100671578 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100671578 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100671578 (ITGA3)
   05414 Dilated cardiomyopathy
    100671578 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100671578 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100671578 (ITGA3)
   04515 Cell adhesion molecules [BR:lav04515]
    100671578 (ITGA3)
   04090 CD molecules [BR:lav04090]
    100671578 (ITGA3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100671578 (ITGA3)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100671578 (ITGA3)
CD molecules [BR:lav04090]
 Proteins
  100671578 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 100671578
NCBI-ProteinID: XP_003414690
LinkDB
Position
Unknown
AA seq 1055 aa
MGPGLRRAPGAPSPVLCALALMVAAGGRVASAFNLDTRFLVVKEARNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTTQKDDCERMSIEEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDRGDDWQTY
HNEMCNSNTGYLETGMCQLGTSGGFTQSTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
DPEDQGNLYIGYTMQVGSAILHPTDITIVTGAPRHQHVGAVFLLSQEAGGDLRRRQVLEG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFDRKEEVGGAIYVFMNQAGNSFPAQPSLL
LHGPSRSAFGFSMASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSRGLLREPQQVIHGE
QLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDQIVLLRARPVINILHKTLVARPSVL
DPALCTATSCVQVELCFAYNQSAGNPSYRQNITLDVHFRRLTGDRRPTPGSALLEAQSAV
FKGFSFSMPEMRFQTLELLLMDNVRDKLRPILISMNYSLHLRMPERPRVGMRSLDAYPVL
NQAQALENHTEVHFQKECGPDNKCESNLGMQADFVTEQMQRLRRLQYGRDTRKLLLSINV
TNFPSQIRAGEDAHEALLTVEVPPALLLSSVRPPGACQANESILCELGNPFKRNQRMELL
IAFEVIGVTLHTRELQAQLQLSTSSHQDDLQAITLPLLVDYMLQASLSMVSHRLQSFFGG
TVMGEAGMKTVEDVGSPLKYEFQVGPMGEGLAALGTLVLGLEWPYEVANGKWLLYPTEIT
VHGNGSWPCQPPGGLVNPLNLTFSVPGDGPPSPQRRRRRQLDPGRGQGPPPVILAAAKKA
KSETLLTCANGRAHCVWLECPIPDAPVITNVTVQARVWNSTFIEDYKDFDRVRVNGWATL
FLRTSVPTINMENKTIWFSVDIDSDLVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKC
GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3168 nt   +upstreamnt  +downstreamnt
atgggccccggcctgcgccgcgcacccggtgccccgagcccagtgctctgcgccctcgcc
ttgatggtggccgccggcggccgcgtcgcctccgccttcaacctggacacccgattcctg
gtggtaaaggaggccaggaacccgggcagcctcttcggttactcggtcgccctccatcgg
cagactgagcggcagcagcgctacctgctcctggctggtgccccccgggaccttgctgtg
cctgatggctacaccaaccggaccggtgctgtgtacctgtgcccactcactacccaaaag
gatgactgtgagaggatgtccatcgaggagaaaagtgaccctgaccatcacatcattgaa
gacatgtggctcggggtgactgtggccagccagggccctgcgggcagagtcctggtctgc
gcccaccgctatacccaggtgctgtggtcggggtcggaggaccagcggcgcatggtgggc
aagtgttacgtgcggggcaatgacttagagctggaccgcggtgatgactggcagacctac
cacaacgagatgtgcaacagtaacaccggctacctggagacgggcatgtgccagctgggc
accagtggcggcttcacccagagcaccgtgtatttcggggcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatcagaatacagttacaag
gacccagaagaccaaggaaacctctacattgggtacacaatgcaggtgggcagcgctatc
ctgcacccaacggacatcaccattgtgactggtgccccacggcaccaacatgtgggcgct
gttttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
acgcaggtgggcgcctactttggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctagtgggtgccccctactactttgaccgtaaagaagaggtagggggt
gccatctacgtcttcatgaaccaggcgggcaactccttccctgcccaaccctccctcctt
cttcacggccccagtcgctcagcttttggcttctccatggccagcattggtgacataaac
caagatgggttccaggacattgctgtgggagccccgttcgagggcttgggcaaagtgtac
atctaccacagcagctccagggggctcctcagagagccccagcaggtaatccacggagaa
cagctggggcttcctggcttggccaccttcggctactccctgagtgggcagatggacgtg
gatgagaacttctacccagacctgctagtgggcagcctgtctgaccagatcgtgctgctg
cgagcccggcctgtcatcaacatcctccataagaccttggtggccaggccatctgtactg
gaccccgcactctgcacagccacctcctgtgtgcaggtggagctgtgctttgcttacaac
cagagcgctgggaaccccagctacaggcaaaacatcaccctggacgtacactttaggagg
ctgaccggggaccgcaggcccacccccggctccgctttgctcgaagcccagtcagccgtc
ttcaaagggttttctttttccatgcccgagatgcgcttccagacactggagttgcttctg
atggacaacgtccgtgacaaactccgtcccatcctcatctccatgaactactctttacac
ttgcggatgcccgagcgtccccgggtggggatgcggtccctggacgcctaccccgtcctc
aaccaggcgcaggcgctggagaaccacactgaggtccacttccagaaggagtgcgggcca
gacaacaagtgcgagagcaacttggggatgcaggcggacttcgtgacagagcagatgcag
cggctgagaaggctccagtacggcagagacacccggaagctgctcctgagcatcaatgtg
accaacttccccagccagattcgggctggggaagatgcccacgaggcgctgctcaccgtg
gaggtgcctcccgccttgctgttgtcctcagtgaggccccccggggcctgccaggccaat
gaaagcatcctctgtgagctggggaaccccttcaaaaggaaccagaggatggagctgctc
attgccttcgaggtcatcggggtgaccctgcacacaagggaacttcaggcacagctgcag
ctgtccacgtctagtcaccaggatgacttgcaggcaataaccctgcctctgctggtggac
tacatgctccaggcctcactcagcatggtgagtcaccggctacaaagcttctttgggggg
acagtgatgggtgaggctggcatgaaaactgtggaggatgtgggaagtccactcaagtat
gagttccaggtgggcccaatgggggaggggctggcagccctggggaccttggtcctggga
ctggagtggccttatgaagtcgccaatggcaagtggctactgtaccccacggagatcact
gtccatggcaacggatcctggccctgccagccaccaggaggccttgtcaaccctctcaac
ctcactttttctgtcccaggggatgggccgccatctccacagcgcaggcgacgacggcag
ctggaccctgggagaggccagggccccccgcctgtcattctggctgctgccaaaaaagcc
aagtctgagaccctactgacctgtgccaatggtcgcgcccactgtgtgtggctagagtgc
cccattcctgatgctccagtcatcaccaacgtgaccgtgcaggcccgggtgtggaacagc
accttcatcgaggattacaaagactttgaccgagtcagggtaaatggctgggccaccctg
ttcctccgaaccagtgtcccgaccatcaacatggagaataagaccatatggttctctgtg
gacattgactctgacctggtggaggagttgccggcagagatcgagctgtggctggtgctc
gtggctgtgggtgcggggctgctgcttctgggactgatcatcctcttgctgtggaagtgc
ggcttcttcaagcgagcccgcactcgcgccctgtatgaagctaagaggcagaaggcggag
atgaagagccagccgtcagagacggagaggctgaccgacgactactga

KEGG   Loxodonta africana (African savanna elephant): 100674409
Entry
100674409         CDS       T04351                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04640  Hematopoietic cell lineage
lav04670  Leukocyte transendothelial migration
lav04672  Intestinal immune network for IgA production
lav04810  Regulation of actin cytoskeleton
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674409 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100674409 (ITGA4)
   04514 Cell adhesion molecules
    100674409 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674409 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674409 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100674409 (ITGA4)
   04670 Leukocyte transendothelial migration
    100674409 (ITGA4)
   04672 Intestinal immune network for IgA production
    100674409 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674409 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100674409 (ITGA4)
   05414 Dilated cardiomyopathy
    100674409 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100674409 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674409 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100674409 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674409 (ITGA4)
   04515 Cell adhesion molecules [BR:lav04515]
    100674409 (ITGA4)
   04090 CD molecules [BR:lav04090]
    100674409 (ITGA4)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100674409 (ITGA4)
  Exosomal proteins of other cancer cells
   100674409 (ITGA4)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100674409 (ITGA4)
CD molecules [BR:lav04090]
 Proteins
  100674409 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF11 Integrin_alpha
Other DBs
NCBI-GeneID: 100674409
NCBI-ProteinID: XP_003406015
LinkDB
Position
Unknown
AA seq 1032 aa
MADEARRGVGPRAAAIREVVMLLLFLGIPMGRPYNVDTESALLYRGSPGTLFGYSVVLHR
HGTNRWLVVGAPTDNWLSNASVINPGAIYRCRIGKNPNRTCEQLQLGSPHGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVACGHRWKNIFYMKHENKLPTGVCYGMPSDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSVFVYNITTNIYKAFLD
KHNQVKFGSYLGYSVGAGHFQSQHTTEVVGGAPQHEQIGKAYIFSIGAKGLNILYEMKGK
KLGSYFGASVCALDLNADGLSDLLVGAPMQSTIREEGRVFAYINSGTGAVMNEMETELIG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRVDGISPTFSQRIEG
LQISESLSMFGQSISGQIDADDNGYLDVAVGAFQSDSAVLLRTRPVVIVEASLNHPESVN
RTKFDCMENGLPSVCMNLKLCFSYKGKKVPGHIVLVYNMSLDVNRKAESPSRFYFSSNGT
SDVITGSIQVSSRAANCRTHQAFMRKDVRDILTPIQIEAAYHLGRHIISKRSTEEFPPLQ
PILQQKKEKDMIKKTINFARFCAHENCSADLQVSAKIGFSKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYDTTLHIKLPTGLYFIKILDLEEKQINCDITDNSGIIKLDCSVGYIYVDR
LSRLDVSFLLDASSLSQAEEDLSITVHTACENEEGVDTLENNKVTLAIPLKYEVMLSVHG
FVNPTSFVYGSHEENEPQTCMAEKINFTFRVINAGNSMAPNVSMEIMVPNSFTPHTDKLF
NILDVQTTSGECHFKNYQRECLQQQKSALETMKDIFRFLSKSDKRLLYCIIDDPYCLNFM
CNFGKMESRKEASVHIQLEGRPSVLEMDETSTLKFEIRATTFPEPNPKVIELNKDENVAH
VLLEGLHHQRPKRYFTIVIISSSLLLGLILLLLISYVMWQAGFFKRQYKAILKEENKRDS
WSYVNSKGDNDE
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggctgacgaagcaaggcgcggtgtcggcccccgagcggccgccatccgggaggtggtg
atgctgctgctgtttctggggatcccaatgggacgcccctacaacgtggacacggagagt
gcgctgctctacaggggctcccctggcaccctgttcggctactcggtggtgctgcacagg
cacgggaccaaccgatggctcgtagtgggggcgcccactgacaactggctctcgaacgcc
tcagtgatcaatcccggggcgatttacagatgcagaatcggaaagaacccaaaccggacg
tgtgaacagctccagctgggcagccctcatggagagccttgtggaaagacttgcttggaa
gagagagacaatcagtggttgggggtcacactttccagacagcccggagaaaatggatcg
attgtggcttgtggtcatagatggaaaaatatattctacatgaaacatgaaaataagctc
cccactggtgtttgctatggaatgccgtctgatttacgaacagaactgagtaaaaggata
gctccgtgttatcaagattatgtgaaaaaatttggggaaaactttgcatcgtgtcaagct
ggaatatctagtttttatacaaaggacttaattgttatgggagccccaggatcatcttac
tggactggctctgtctttgtctacaatataactacaaatatatacaaggcttttttagac
aaacataatcaagtaaaatttggaagttatttaggatactcagttggagctggtcatttt
cagagtcagcacactacagaagtagttggaggagctccacaacatgaacagattggtaaa
gcatacatattcagcattggtgcaaaaggtctaaatattttatatgagatgaaaggtaaa
aagctcggatcatactttggagcttccgtttgtgccctggacctcaacgcagacggcctc
tcggacctacttgtgggagctcccatgcagagcaccatcagggaggagggaagagttttt
gcatacatcaactctggcacgggagcagtaatgaatgaaatggaaacagagctcattgga
agtgacaaatatgctgcaagatttggggaatctatagttaatcttggcgacattgacaat
gatggctttgaagatgtcgctatcggggctccacaagaagatgacttgcgaggcgctatt
tatatttacaatggccgagtagatggaatctcgccaaccttctcgcagagaattgaagga
cttcagattagtgaatcattaagtatgtttggacagtctatatctgggcaaattgatgca
gatgataatgggtacttagatgtggcagttggtgcttttcagtctgattctgctgtgttg
ctaaggacaagacctgtagtgattgttgaagcttctttaaaccaccctgagtcggtgaat
agaacaaaatttgactgtatggaaaatggattgccttctgtgtgcatgaatctaaaactc
tgcttttcatataagggcaaaaaggttccaggtcatatcgttttggtttataacatgagt
cttgatgtgaacagaaaggccgaatctccatcgagattttacttttcttctaatggaact
tctgatgtgattacgggaagcatacaagtatcaagcagagcagctaactgtagaacacat
caggccttcatgcggaaagatgtgcgggacatccttactccaattcaaatagaagctgcc
taccacctcgggcgtcacatcatcagtaaacgaagtacagaggaattccccccccttcag
ccaattcttcagcagaagaaagaaaaagatatgattaaaaaaacgataaactttgcgagg
ttttgtgcccatgaaaattgctctgctgatttacaggtgtctgcaaaaattggattttca
aagccacatgaaaataaaacctatcttgctgttggaagtatgaagacgttgatgctgaac
gtgtctttgtttaatgctggagacgatgcctatgataccactctgcatatcaaactcccc
acaggtctttacttcattaagattttagacctggaagagaaacaaataaactgcgacata
acagacaactcaggcataatcaaactggactgcagtgttggctatatatatgtagatcgc
ctgtcaaggctagatgttagcttcctcctggacgcaagctctctcagccaagcagaagaa
gatctcagcatcacagtgcataccgcctgtgaaaatgaagagggagtggacactctagag
aataacaaagtgactttagcaatacctctaaagtatgaggttatgctcagtgttcatggg
tttgttaacccaacgtcgtttgtttatggatcacatgaggaaaatgaacctcaaacgtgc
atggcggagaaaattaacttcactttccgtgttatcaatgctggcaatagcatggctcca
aatgttagcatggaaataatggtcccgaattcttttaccccccacaccgataaactgttc
aacattttggatgtgcagactactagtggtgagtgccattttaaaaattatcaaagagag
tgtttacagcagcaaaagagtgcattggagaccatgaaagacatattcagattcttgtca
aagtctgataagaggctattgtactgcataatagatgatccatactgtttaaatttcatg
tgcaattttgggaaaatggaaagtagaaaagaagccagtgttcacattcaattggaaggc
cggccatctgttttagaaatggatgaaacatcaacactcaagtttgaaataagagcgaca
acttttccagagccaaatccaaaagttattgaattaaacaaggatgagaatgttgcacac
gttctactagaaggtctacatcatcaaagacccaaacgatatttcactatagtgattatt
tcaagtagtttgctacttggacttattttacttttactgatttcgtatgtaatgtggcag
gctggcttctttaaaagacaatacaaagctatcctcaaagaagaaaataaaagagacagt
tggagttatgtgaacagtaaaggcgataatgatgaataa

KEGG   Loxodonta africana (African savanna elephant): 100674420
Entry
100674420         CDS       T04351                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674420 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100674420 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674420 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674420 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100674420 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674420 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100674420 (ITGA1)
   05414 Dilated cardiomyopathy
    100674420 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674420 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674420 (ITGA1)
   04515 Cell adhesion molecules [BR:lav04515]
    100674420 (ITGA1)
   04090 CD molecules [BR:lav04090]
    100674420 (ITGA1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100674420 (ITGA1)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100674420 (ITGA1)
CD molecules [BR:lav04090]
 Proteins
  100674420 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 100674420
NCBI-ProteinID: XP_010586440
LinkDB
Position
Unknown
AA seq 1179 aa
MAPQLYTSPRVAVACCWFLTALLGFCISFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLAGQPKNRTGDVYKCPVGRNKSSPCIKLDLPVNTSIPNVTEAKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPIRECSTQLDIVIVLDGS
NSIYPWESVTDFLNDLLEKMDIGPKQTQVGIVQYGENVTHEFNLNKYSTTEEVRVAASKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHQLNKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIRSIASEPTEKHFFNVSDELALVTIVEALGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKADQIIVPPNTT
FNVESTKKKEPLASYLGYTVNSATVSGDVLYIAGQPRYNHTGQVIVYRMENRDIQILQTL
HGEQIGSYFGSVLTTIDIDKDSNTDILLVGAPTYMGTEKEEQGKVYVYALNQTRFEYQMS
LEPIKQTCCSSLKHDSCTKENRNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHAG
AVYIYHGSGKTIKEEYTQRIPSGGDGKTLKFFGQSVHGEMDLNGDGLTDVTIGGLGGAAL
FWSRDVAVVKVTMNFEPNKVNIENKNCQVEGKETVCINATVCFDVKLKSKEDVMYEADLQ
YRVTLDSLRQISRSFFSGTQERKIQRNITVRGSECTKHFFYMLDKHDFRDSVRITLDFNL
TDPENGPVLDDSVPNSVHEYIPFAKDCGNKEKCISDLGLDVSTIEKGLLIVKSHNDKFNV
SLTVKNKKDSAYNTRTITNYSPNLIFSGIEAIQKDSCESNHNITCKVGYPFLRRGEEVTF
KIVFQFNASYLMENVIIHLTATSDSEEPPEALSDNEVNISIPVKYEVGLQFYSSASEYHI
SIAANETVPESINSTEDIGNEINIFYLIRKSGHFPMPELKLSISFPNLTSDGYPVLYPTG
WSSSDNANCRPNSLQDPLGINSGKKTIIFKSEDLKRGTILDCSTCKFAAITCNLMPSDVS
QVNVSLTLWKPTFIKARFSSLNLTVRAELQSENTSLVLNSGNKKRELAIQVSKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggccccccagctctacaccagcccaagggtcgccgtcgcctgctgctggttcctcact
gctcttctaggcttctgcatatcattcaatgttgatgtgaaaaactcaatgactttcagt
ggcccagtggaggacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagctggccaacccaagaacagaactggagatgtctat
aaatgtccagttggaagaaacaaatcatcaccttgcataaaattggacctaccagttaat
acatcaattcctaatgtcacggaagcaaaggagaacatgacctttggatcaactttagtc
accaacccaaacggagggtttctggcatgtggacccttatatgcctatagatgtggacat
ttacattacacaactggaatctgttcagatgtcagccccacatttcaagtcgtgaactcc
attgcccctatacgagaatgtagcactcagctggacatagtcatagtgctggatgggtcc
aacagtatttacccctgggaaagtgttacagattttttaaatgacctgctggaaaaaatg
gatattggccctaaacagacacaggttggaattgtacagtatggagaaaacgtaacccat
gagttcaacctcaataagtattcaacaacagaagaagtacgtgttgcagcaagtaaaata
gtccagagaggtggtcgccaaactatgacagcccttggaatagacacggcaaggaaagag
gctttcactgaagcccggggtgcacgaaggggggttaaaaaagtcatggttattgtgact
gatggagagtcccatgacaaccaccaactgaataaggtcatccaagactgtgaagatgaa
aatattcagcggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gagaaatttgtggaggaaatacgatcaattgcaagtgagcccactgaaaagcatttcttc
aacgtgtctgatgaactggctctggtcactattgttgaagctctgggagaaagaatattt
gccctggaagctacagctgatcagtcagcagcttcgttcgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggattgggttatgcttggagcagtaggagcctatgat
tggaatgggaccgtcgtcatgcagaaggctgatcaaatcatcgtccccccaaatacaacc
tttaatgtcgagtctaccaaaaagaaagaaccccttgcatcttacttaggttacacagta
aactctgctactgtttctggagatgtcctctatattgctggacaaccgaggtacaatcac
acaggccaggtcattgtctacaggatggaaaatagggatatccagattctccagacactc
catggagaacagatcggttcttactttggcagtgttttaacaaccattgacattgataaa
gattcaaatactgatattctcctggttggggctcccacgtacatgggaacggagaaggaa
gaacaaggaaaagtgtacgtgtacgccctgaatcagacaaggtttgaatatcaaatgagc
ctggaacccattaaacagacttgctgttcgtctctgaagcacgattcatgcacaaaggaa
aacagaaacgagccatgcggggctcgttttggaacagcgattgcggctgtaaaagatctc
aatcttgatggatttaatgacatcgtgataggagctccactagaagatgatcatgcgggt
gctgtgtacatttatcatggaagtggcaagacgataaaggaagagtatacacaacgtatt
ccatcaggtggagatggtaagacactgaaattttttggccaatctgtccatggagaaatg
gatttaaatggtgacggtctgactgatgtgactatcggaggccttggtggtgctgccctc
ttctggtcccgagatgtggctgtagttaaagtaaccatgaattttgaacccaacaaagtg
aatattgaaaataaaaactgccaggtggaaggaaaggaaacagtgtgcataaatgctaca
gtgtgttttgatgtgaagctaaagtccaaagaagatgtgatgtatgaagctgatttgcag
taccgtgtcacactagattcactaagacagatatcacgaagttttttctctggaactcaa
gaaagaaagattcaaagaaacatcacagttcgaggctcagaatgcactaagcacttcttc
tacatgttggacaagcatgactttcgagactctgtgaggataactttagattttaatctt
actgatccagaaaatggacctgttcttgatgattctgtaccaaactcagtacatgaatat
attccctttgccaaagattgtggaaacaaggaaaaatgtatctcagaccttggcctagat
gtatccactatagaaaagggcctgttgatcgtcaagtcccacaatgataagttcaacgtt
agcctaacagtgaaaaataaaaaggacagtgcgtataacaccagaacaatcacgaactat
tctccaaacctaattttttcaggaattgaggctattcaaaaagacagttgtgaatccaat
cataatatcacatgtaaagttggatatcctttcctgagaagaggagaagaggtaactttc
aaaatagtatttcagtttaacgcatcttatctcatggaaaatgtcatcattcatttaact
gcaacaagtgacagtgaagaacctcctgaagccctttctgacaatgaggtaaacatttct
atccctgtgaaatatgaagttggactacagttttacagctctgcaagcgaataccatatt
tcaattgcggccaatgaaacggtccctgaaagtattaattctactgaggacattggaaat
gagattaacatcttctacttgattagaaaaagtggacatttcccaatgccagaacttaag
ttgtcaatttcattccccaatttgacatcagatggttaccctgtgctgtacccaactgga
tggtcatcttctgataatgcaaactgcagacccaatagccttcaggatcctcttggaatc
aattctgggaagaaaacgattatattcaaatctgaagatctcaaacgaggcacaattctg
gactgtagtacgtgtaaatttgctgccatcacatgtaatctgatgccttctgatgtgagc
caagtgaatgtttcacttaccttatggaaaccaacttttataaaagcacgtttttccagc
ttaaatcttactgtacgggcggaacttcagagtgaaaatacatccttggttttaaatagt
ggcaataaaaaacgagagcttgctattcaagtatccaaagatgggctaccaggcagagtg
ccattgtgggttatcctgttgagtgcttttgcgggcttactgctgttaatgctgctcata
ttagccctgtggaagatcggattcttcaagagaccactaaaaaagaaaatggagaaatga

KEGG   Loxodonta africana (African savanna elephant): 100674705
Entry
100674705         CDS       T04351                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04611  Platelet activation
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05222  Small cell lung cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674705 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100674705 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100674705 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674705 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674705 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100674705 (ITGA2)
   04611 Platelet activation
    100674705 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674705 (ITGA2)
   05205 Proteoglycans in cancer
    100674705 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100674705 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674705 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100674705 (ITGA2)
   05414 Dilated cardiomyopathy
    100674705 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674705 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100674705 (ITGA2)
   04515 Cell adhesion molecules [BR:lav04515]
    100674705 (ITGA2)
   04090 CD molecules [BR:lav04090]
    100674705 (ITGA2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100674705 (ITGA2)
  Exosomal proteins of bladder cancer cells
   100674705 (ITGA2)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100674705 (ITGA2)
CD molecules [BR:lav04090]
 Proteins
  100674705 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 100674705
NCBI-ProteinID: XP_010586441
LinkDB
Position
Unknown
AA seq 1183 aa
MRPGRAESELLRLRLRLVLMFSQGILNCCVAYNVGLPEAKIFSGPSSEQFGYAVQQFINP
KGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLT
LTRNVGTGGFLTCGPLWAQQCGNQYYTTGVCSEVSPDFQHLASFSPAVQTCPSFIDVVVV
CDESNSIYPWDAVKSFLEKFVQGLDIGPQKTQVGLIQYGNNPRVVFNLNTYKTKAEMIKA
TTRTYQHGGDLTNTFKAIQYARDFAYSAAAGGRPHATKVMVVVTDGESHDGSMLKAVIEQ
LNNDNILRFGIAVLGYLNRNTLDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLG
EQIFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAYAWSGTIVQQTSRGHLI
FPKQAFDQILQDRNHSSYLGYSVAVISTRKNIHFVAGAPRANYTGQIVLYRVDENGNVTI
IQPHRGDQIGSYFGSVLCSVDVDRDTITDVLLVGAPMYMNDLKKEEGRVYLFTITKGILN
HHQFLEGPEGFENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQSTIRT
KYSQKILGSDRAFRSHLQYFGRSLDGHGDLNGDSITDVSIGAFGQVVQLWSQSIADVSVE
AFFTPEKITLLKKNAEIILKLCFSAKFRPTNQINQVAITYNVTLDADRFSSRVTSRGLFK
ENNERFLQRNMVVNQAQSCSEHIIHVQEPSDVVNPLDLRVNISLENPGTSPALEAYSETA
KVFRIPFYKDCGDDGLCISDLVLSVQQLPADQKQPFIVSNQHKRLTFSVTLKNKKESAYN
TRIVAAFSENLFFASSSMPVDGTEVTCQVDSSQKSVTCNVGYPALKRKQQVTFTVNFDFN
LQNPQNQASVSFQALSESHEENQADNLVTFKIPLLYDADIHLTRSTSINFYEVSSDGKVP
SIIHDFEDIGPKFTFSLKVTTGGAPVSMAYVTIHIPQYTKEKNPLMYLTGVQTDQAGDIG
CNAEINPLKIGQASSSVSFKSENFRHMKELNCRTASCSSVTCWLKDLQAKGEYFVNVSTR
IWNGTFAASTFQAIQLTGSAEIDTYNPQIYVIEENTVMIPVIIMKPGEKAEVPTGVIVGS
IIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDEMTEINS
NT seq 3552 nt   +upstreamnt  +downstreamnt
atgcgaccaggacgcgcggagagcgagctgctgcggctgcggctgcggctggtactaatg
ttcagtcaaggaattttaaattgttgcgtggcatacaatgttggtcttccagaagcaaaa
atattttctggtccttcaagtgaacagtttggctatgcagtgcagcagtttataaaccca
aagggaaactggttactggttggttcaccttggagtggctttcctgagaaccgaatggga
gacgtgtataaatgtcctgttgatctatccactgctacatgtgaaaaactgaatttgcaa
acttcaaccagcattccaaatgttactgagatgaaaaccaacatgagccttggcttgacc
ctcacaaggaacgtgggaaccggagggtttctaacatgtggtcccctatgggcacagcag
tgtggaaatcagtattacacaaccggcgtttgctctgaggtcagtcctgattttcagcac
ttggccagcttttcacctgcagttcagacctgcccttccttcatagatgtggtggttgta
tgtgatgaatcaaatagtatttatccgtgggatgcagtaaagagttttttggaaaaattt
gtacaaggcctggacataggcccccaaaaaacacaggtggggttaattcaatatggcaat
aacccaagagttgtgtttaacctgaatacttataaaaccaaagctgaaatgattaaagca
acaacccgaacgtaccaacatggtggggacctcacaaatacattcaaagcaattcaatat
gcaagagattttgcttattcagcagctgctggtggacgaccacatgctaccaaagtaatg
gtggttgtaactgatggtgaatcacacgatggttcaatgttgaaagcagtgattgaacag
ttaaacaatgacaatatactgaggtttggcatagcagttcttggatacttaaacagaaac
acccttgatactaaaaatttaataaaagaaataaaagcaattgccagtattccaacagaa
agatactttttcaatgtgtctgatgaagcagcactactagaaaaggctgggacattagga
gaacaaattttcagcattgaaggtactgtccaaggaggagacaacttccagatggaaatg
tcacaagtgggattcagcgcagattactctccacaaaatgatattctgatgctgggtgca
gtgggagcttatgcctggagtggaactattgtccagcagacatctcgtggacatttgatc
tttcctaaacaagccttcgatcaaattctgcaagacagaaaccacagttcatatttaggt
tactctgtggctgtgatttctactagaaaaaacatccactttgttgctggtgctcctcga
gcaaattatactggccagatagtgctataccgtgttgacgagaatggtaatgtcacaatt
attcagcctcacaggggtgaccagattggctcctattttggtagtgtgctgtgttcagtg
gatgtggatagagacaccattacagatgtactcttagtaggtgcaccaatgtatatgaat
gacctgaagaaagaggaaggaagagtctacctatttactatcacaaagggcattttgaac
catcaccaatttcttgaaggccctgaaggctttgaaaatgctcgctttggctcagcaatt
gcagctctttcagacatcaacatggatggctttaatgatgtgatagttggttcaccttta
gagaatcagaactctggagctgtgtatatctacaatggtcatcagagcaccattcgcaca
aagtattcccagaaaatcttgggatccgatagagcttttagaagtcatctccaatacttt
gggagatccttggatggccatggagatttaaatggggattccatcactgacgtgtctatc
ggtgcctttggacaagtggttcaactctggtcacagagcatcgctgatgtatctgtagaa
gcttttttcacaccagaaaaaatcactttgctcaagaagaatgctgaaataattctcaaa
ctctgtttcagtgcaaaatttagacctactaatcaaatcaatcaagtggctattacatat
aacgtcaccctcgatgcagatcgattttcatccagagtgacctccaggggattatttaaa
gaaaataatgaaagattcctgcagaggaatatggtggtaaatcaagcacagagttgctct
gagcacatcatccatgtgcaggagccctctgatgttgtcaaccctttggatctgcgtgtg
aacatcagcctggagaaccctggcactagtcctgcccttgaagcctattctgagacagcc
aaggtcttcaggattcctttctataaagattgtggtgatgatggactttgcatttctgat
ctagttctcagtgttcagcagctcccagctgatcaaaaacaaccctttattgtcagcaac
caacacaaaaggttaacattttcagtaacactaaaaaacaaaaaggagagtgcatacaac
acaagaattgttgctgctttttcagaaaacttgttttttgcttcgtcctctatgccggtt
gatgggacagaagtcacatgccaggttgattcatctcagaaatctgttacctgcaatgta
ggctaccctgctttaaaaaggaaacaacaggtgacttttactgttaacttcgacttcaat
cttcaaaaccctcagaatcaggcatctgtcagtttccaagccctaagtgaaagccatgaa
gaaaatcaggcagataatttggtcaccttcaaaattcctctgctgtatgatgctgacatt
cacttaacaagatctaccagcataaatttttatgaagtttcttcagatggtaaagttcct
tccatcatacatgattttgaagatattggtccaaaattcaccttctcccttaaggtaaca
acaggaggtgcgccagtaagcatggcatatgtgaccatccacatccctcaatatacaaaa
gaaaagaacccactgatgtacctgactggggtgcagacagaccaggctggtgacatcggt
tgtaatgcagaaataaatccactgaaaataggacaagcatcttcttctgtatctttcaag
agcgaaaatttccggcatatgaaagaattgaattgcagaactgcttcatgtagcagtgtt
acctgctggctgaaagaccttcaggcgaaaggagaatactttgttaatgtgtctaccaga
atctggaatgggacttttgcagcatcaactttccaggcaatacagctgacagggtctgca
gaaattgacacctataaccctcagatatatgtgattgaagaaaacaccgtcatgattcct
gttataataatgaagcctggtgagaaagctgaagtaccaacaggagttatagtaggaagc
ataattgctggaatccttttgctcttagctctggttgcaattttatggaagctcggcttc
ttcaaaagaaaatatgaaaaaatgaccaagaatcctgatgagattgatgagatgacagaa
ataaacagttga

KEGG   Loxodonta africana (African savanna elephant): 100674808
Entry
100674808         CDS       T04351                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04514  Cell adhesion molecules
lav04810  Regulation of actin cytoskeleton
lav05165  Human papillomavirus infection
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100674808 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100674808 (ITGA8)
   04514 Cell adhesion molecules
    100674808 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674808 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100674808 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100674808 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100674808 (ITGA8)
   05414 Dilated cardiomyopathy
    100674808 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674808 (ITGA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lav04515]
    100674808 (ITGA8)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100674808 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100674808
NCBI-ProteinID: XP_010589007
LinkDB
Position
Unknown
AA seq 1062 aa
MSARARCGLAGSRAQPLAPLWCFSAALGMLWSPVSQAFNLDVERLTVYSGPDDSYFGYAV
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGAAVRAHRGNVVACAPLYHWRTLKPTSEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGMFLRVNIADIIANYS
FKDILRKLAREKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVTVSDVNNDGMDDILIGAPIFMEREFESNPKEVGRVY
LYLQSSPLIFRDAQVLTGTKVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGKDQQGKVLI
YNGNKDGLNIKPSQILQGAWASQAVPSGFGFTLRGDSDIDKNDYPDLLVGAFGTGKVVVY
RARPVVTVDAQLLLNPVIINLENKTCQIPDSMTSVACFAVTVCASVAGQSISNTIALTAE
VQLDSLKQKGAIKRTLFLDNHQSHLIFPLVIRRQKALQCQDLIVYLRDETEFRDKLSPIN
ISLNYSLDESIFKEGLAVKPILNYYRVNAVSEQAHILVDCGEDNICIPVLKLSARPDKDQ
VIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERSNKGLRPLSCEYKMENVT
RMVVCDLGNPMVAGTNISLGLRFAVPRLEKTNVSINFDLQIRSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHREEEVGPLVEHIYEMHNTGPSTISETLLE
VGWPFSSRGEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAASPEDTSELSAFLRNSTIPH
LVKKRDVPVMELHRQSPAKILNCTNIKCLQISCVVGRLEGGESAVLKIRSRLWAQTFLQR
KNNPYSLASLVSFEVKKMPYKDQPVKLPRGSMAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDTTDREQLTNDKTPDA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtctgcccgcgcccgctgcggtctggcggggagccgggcacagccgctcgcacccctc
tggtgcttctcggctgccctggggatgctgtggtctcccgtctcccaggcgttcaacttg
gacgtggagaggctcacggtgtacagcggccccgacgacagctacttcggctacgccgtg
gacttctacatacctgacgcgcgcacagcgagtgtcttggtgggggcccccaaagccaac
acaagccagccggatatcgtggaagggggcgccgtctattattgcccctggccggccgag
gggtctgctcagtgcaagcagataccatttgacaccaccaacaacagaaagatcagagtt
aacggaaccaaagaacctatagagttcaaatcgaaccagtggtttggagcagcagtgaga
gctcaccgcgggaacgttgtggcctgtgcccctttatatcactggagaactcttaagccg
acatcagaaaaggatccggttggcacttgctatgtagcaattcagaatttcagcgcgtat
gctgagtactctccttgtcggaacagcaatgccgatcctgaaggccagggttactgccaa
gcaggatttagtttggatttttataagaatggagatcttatagtaggaggacctggcagt
ttttactggcaaggtatgttcttaagagttaacattgcagatatcattgcaaattactca
ttcaaggatattctaaggaaactggctcgcgaaaaacagacagatgtggctccagcttct
tacgacgatagttaccttggatactcagttgctgctggggaatttactggagactctcag
caagaattggttgctggaattccaagaggtgcacagaattttggatatgtttcaattatt
aactctaccgatatgacctttattcagaacttcactggtgaacagatggcatcatatttt
ggatatactgttacagtatcagatgttaacaatgacggaatggatgacatattgattggg
gcacctatcttcatggaacgcgaatttgagagtaatcctaaagaagttgggcgagtttac
ctgtatttgcaatcaagccctctcatcttcagagacgcgcaggtcctgacaggcactaag
gttttcgggagattcggcagtgctgtggcacatttaggagacctgaaccaagatggatac
aatgacattgcaattggagcgccctttgcaggcaaggaccaacaaggcaaagtgctcatt
tacaacggaaacaaggacgggttaaacataaagccttcccaaattctgcaaggagcttgg
gcctcacaggctgtcccttcaggatttggttttactttaagaggagattcggacatagac
aagaatgattacccagatttacttgtgggcgcatttggaaccggaaaagtagttgtttac
agagcgaggccggttgtgactgtagacgcccagcttctgctgaacccagtgatcatcaat
cttgaaaataaaacttgccagattccagattcgatgacatctgtggcctgctttgctgta
acagtgtgtgcatcggtagcaggccagagcatttcaaacacaatagccctgactgctgag
gtgcagttagattcactgaaacaaaaaggagccattaaacgaacactcttccttgacaac
catcagtcccatctcatcttccctcttgtgataagacggcagaaagccctccagtgccag
gaccttatcgtttaccttcgagatgaaactgaattccgagataaattatctccaatcaac
attagtttgaattacagtttggatgaatccatctttaaagaaggcctggcagtgaagcca
atactgaactactacagagtaaacgctgttagtgagcaggctcacatcctggtggactgt
ggagaagacaatatatgcattcctgtcttgaagctgtcagctagaccagataaggatcag
gtaatcattggggatgaaaatcaccttatgctcataataaatgcaagaaatgaaggggaa
ggagcctatgaagctgaactctttgtaatgataccagaagaggcagattatgttgggatc
gaacgcagcaacaaggggctgcggccactgagctgtgagtacaagatggaaaatgtgacc
agaatggtggtgtgtgaccttgggaaccctatggtggctggaacaaatatttctctgggc
ctccgatttgcagttccacgtctcgagaaaacaaacgtgagcattaacttcgatctccaa
atcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaaatcaacatc
actgctgtagctcaagtagaaataagaggagtttcccaccctccacagattgttctgccc
attcataactgggaaccagaagaagagccccacagagaagaagaagttggacctttggtg
gaacatatctatgagatgcataatactggaccaagtaccatcagtgaaacccttctggaa
gtgggttggccgttctcttctcggggtgaatttcttctctatattttccatattcaaact
ctgggacctctgcggtgccaaacaaatcctgacatcaacccacaggatataaagcctgca
gcctccccagaggacacctctgagcttagcgcctttttgaggaactctaccattcctcat
cttgtcaagaagagagacgtgcctgtgatggagctccacagacaaagccctgcaaaaata
ctgaattgtacaaatattaagtgcttacaaatctcctgtgtggtgggacgattggaagga
ggagaaagcgcagtcctgaaaatcagatcacggttatgggcccaaacattcctccagaga
aaaaacaacccctattctctggcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagtgaaactcccacgaggaagcatggcgattaagacgtcagttatttgg
gcaaccccaaacgtttccttctcaatcccattatgggtaataatattagcaatacttctt
ggattattggttctggccattttaaccttagctttatggaagtgtggattctttgataga
gcaagacctccgcaagatgatacgaccgacagagaacaactgacaaatgacaaaacccct
gatgcatga

KEGG   Loxodonta africana (African savanna elephant): 100676951
Entry
100676951         CDS       T04351                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04510  Focal adhesion
lav04512  ECM-receptor interaction
lav04640  Hematopoietic cell lineage
lav04810  Regulation of actin cytoskeleton
lav05100  Bacterial invasion of epithelial cells
lav05133  Pertussis
lav05135  Yersinia infection
lav05165  Human papillomavirus infection
lav05168  Herpes simplex virus 1 infection
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100676951 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100676951 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100676951 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100676951 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100676951 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100676951 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100676951 (ITGA5)
   05205 Proteoglycans in cancer
    100676951 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100676951 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100676951 (ITGA5)
   05414 Dilated cardiomyopathy
    100676951 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100676951 (ITGA5)
   05133 Pertussis
    100676951 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    100676951 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100676951 (ITGA5)
   05165 Human papillomavirus infection
    100676951 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676951 (ITGA5)
   04515 Cell adhesion molecules [BR:lav04515]
    100676951 (ITGA5)
   04090 CD molecules [BR:lav04090]
    100676951 (ITGA5)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100676951 (ITGA5)
Cell adhesion molecules [BR:lav04515]
 Integrins
  Integrin alpha subunits
   100676951 (ITGA5)
CD molecules [BR:lav04090]
 Proteins
  100676951 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100676951
NCBI-ProteinID: XP_003405118
LinkDB
Position
Unknown
AA seq 1066 aa
MGSRTPGSPLHVVQPRWRPRRQPPLPLLLPLLLLLPPPPGVGGFNLDAEAPAVLSGPSGS
FFGFSVEFYRPGAEGVSVLVGAPKDNTSQPGVLQGGAVYLCPWGASPSQCTPIEFDSKGS
RILESSLSSPEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYL
STDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGKSFLCHP
LAPCTQPPIPAPSPKSPVLPSLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVA
GVPKGNLTYGYVTILNGSDVRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLM
ERTTDGRAQEVGRVYVYLQHPAGMDPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVA
IGVPFGGETQQGVVFIFPGGPGGLGSKPSQVLLPLWAAGHTPDFFGSALRGGRDLDGNGY
PDLIVGAFGVDKAVVYRGRPIVSASASLNIFPAMFNPEERSCSLEGNPVACINLSFCLNA
SGKHVPDSIGFTVELQLDWQKQKGGVRRALFLASRQASLTQTLIIQNGAREDCREMKIYL
RNESEFRDKLSPIHITLNFSLNPQASMDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNIC
VPDLQLEVFRTPHSGEQNHYVYLGDKNSLNLTFHAQNVGEGGAYEAELWVTAPPEAEYSG
LVRHPGNFSSLSCEYSTVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLQDTKKTIQFDF
QILSKNLNNSQSDVVSFRLSVEAQAQVSLNGVSKPETVLFPVSDWHPRDQPQEEGDVGPA
VHHVYELINLGPSSISQGILELSCPQALEGQQLLYVTRVTGLSNCTTTPPLNPQGLELDP
ESSEHHRLQRREAPSRSPASSGPQILKCPEAECFKLRCELGPLHRQESQSLQLHFRVWAK
TFLQREHQPFSLQCEAVFEALKMPYRILPRQLPQKKLQVATAVQWTKAEGSHGVPLWIII
LAILLGLLLLGLLIYVLYKLGFFKRSLPYGTTMEKAQLKPPATSDA
NT seq 3201 nt   +upstreamnt  +downstreamnt
atggggagccggacgccagggtcccctctccacgtcgtgcagccgcgctggcgcccccgg
cgccaacctccgctgccgctactactgccgctgctgctgctgttgccgccgccgcccggg
gtcgggggcttcaacttagacgcggaggccccagcagtgctttccggaccctcgggctcc
ttcttcggcttctcggtggagttttaccggccgggggcggaaggggtcagcgtactggtg
ggagctcctaaggataacactagccaacctggagtgctgcagggtggtgctgtctacctc
tgcccctggggcgctagcccctcacagtgcacccctattgaatttgacagcaaaggttct
cggatcctggaatcttcattgtccagcccagagggggaggagcctgtggagtacaagtcc
ttgcagtggttcggggcaacagttcgagcccatggctcttccatattggcctgtgctcca
ctgtacagctggcgcacagagaaggagccactgagtgatcccgtgggtacctgctacctc
tccacagacaacttcacccgaattctggagtatgcaccttgccgctcagatttcagctgg
gcagcaggacagggttactgccaagggggcttcagtgccgagttcaccaagactgggcgt
gtggtactgggtggacccgggagctatttctggcaaggtaagtccttcctatgccatcca
ttggccccctgcacacagcctcccatccctgctcccagcccgaaatcaccagtccttccc
tccttggttcaggggcagctgcagactcgccaggccagttccatctatgatgatagctat
ctgggatactctgtggctgtgggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacctatggctatgtcaccatccttaatggctcagacgtt
cgatccctctacaacttctcaggggaacagatggcctcctactttggctacgcagtggct
gccacagacgtcaatggggatgggctggatgacctgctggtaggggcgccccttcttatg
gagcggacaaccgacgggcgggcccaggaggtgggcagagtctatgtctacctgcagcac
ccagctggcatggatcccacacccacccttaccctcactggccatgacgagtttggccga
tttggcagctccttgacccccctaggggacctggatcaggatggctacaatgatgtggcc
attggtgtcccctttggtggggagacccagcaaggagtggtgtttatattccctgggggc
ccagggggactgggctctaagccctcccaggttctgctgcccctgtgggcagctggccac
accccggacttctttggctctgccctgcgaggaggccgagatctggatggcaacggatac
cctgatctgattgtgggggcctttggtgtggacaaggctgtggtgtacaggggccgcccc
atcgtgtctgccagtgcctccctcaacatcttccctgccatgttcaacccagaggaacgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tccggaaaacacgtccctgattccatcggcttcacggtggagctccagttggattggcag
aagcagaaggggggagtgcggcgggcgctgttcctggcctcccgacaggcaagcctgacc
cagaccctgatcatccagaatggggctcgggaggactgcagagagatgaagatctacctc
cggaacgagtcagaattccgagacaaactctccccgattcacatcaccctcaacttctcc
ctgaacccccaagcctccatggacagccatggcctccagcctgtcctacattaccagagc
aagagccggatagaggacaaggctcagatcttactggactgtggagaggacaacatctgt
gtgcccgacctacagctggaagtgtttagaaccccccactccggggaacagaaccactat
gtttacctgggtgacaagaactccctgaacctaactttccatgcccagaatgtgggtgag
ggcggcgcctacgaggccgagctttgggtcacggcccctccagaggctgagtattctgga
ctcgtcagacatccagggaacttctccagcctgagctgcgaatactctactgtgaaccag
agccgcctgctggtgtgtgacctgggcaaccccatgaaggcaggagccagtctctggggc
ggccttcggttcacagtccctcatctccaggacacgaagaaaaccatccagtttgacttc
cagatcctcagcaagaatctcaacaactcacaaagcgacgtggtctccttccggctctcc
gtggaggctcaggcccaggtctcccttaatggtgtctccaagcctgagacagtgttattc
ccagtgagtgactggcatccccgagaccagcctcaggaggagggggacgtgggccctgct
gtccaccacgtctacgagctcatcaacctgggccccagctccattagccagggcatactg
gagctcagctgcccccaggccctggaaggtcagcagctactctacgtgaccagggttaca
ggactcagcaactgcaccaccactccccccctcaacccacagggcctggagttggatcct
gagagttccgagcaccaccgactgcaaagacgggaagctccaagccggagtcctgcctcc
tcggggcctcagatcctgaaatgcccggaagcggagtgtttcaagctgcgctgtgagcta
gggccacttcaccggcaagagagccaaagtctgcaacttcatttccgagtctgggccaag
accttcctgcagcgggagcaccagccatttagcctgcagtgtgaagctgtgttcgaagcc
ctgaagatgccctaccgaatcctgcctcggcagctgccccagaagaaactgcaagtggcc
acagctgtacagtggaccaaggcagagggcagccatggggtcccactgtggatcatcatc
ctagccattctccttggcctcctgctcctaggtctgctcatctacgtcctctacaagctt
ggattcttcaaacgctccctcccatacggcactaccatggaaaaagctcagctcaagcct
ccagccacctctgatgcctga

DBGET integrated database retrieval system