KEGG   Loxodonta africana (African savanna elephant): 100654442
Entry
100654442         CDS       T04351                                 

Gene name
TLR2
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04620  Toll-like receptor signaling pathway
lav05132  Salmonella infection
lav05134  Legionellosis
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100654442 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100654442 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100654442 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100654442 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100654442 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100654442 (TLR2)
   05321 Inflammatory bowel disease
    100654442 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654442 (TLR2)
   05134 Legionellosis
    100654442 (TLR2)
   05152 Tuberculosis
    100654442 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100654442 (TLR2)
   05161 Hepatitis B
    100654442 (TLR2)
   05171 Coronavirus disease - COVID-19
    100654442 (TLR2)
   05162 Measles
    100654442 (TLR2)
   05168 Herpes simplex virus 1 infection
    100654442 (TLR2)
   05169 Epstein-Barr virus infection
    100654442 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100654442 (TLR2)
   05144 Malaria
    100654442 (TLR2)
   05145 Toxoplasmosis
    100654442 (TLR2)
   05140 Leishmaniasis
    100654442 (TLR2)
   05142 Chagas disease
    100654442 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100654442 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100654442 (TLR2)
   04054 Pattern recognition receptors [BR:lav04054]
    100654442 (TLR2)
   04090 CD molecules [BR:lav04090]
    100654442 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100654442 (TLR2)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100654442 (TLR2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100654442 (TLR2)
Pattern recognition receptors [BR:lav04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100654442 (TLR2)
CD molecules [BR:lav04090]
 Proteins
  100654442 (TLR2)
Glycosaminoglycan binding proteins [BR:lav00536]
 Hyaluronan
  Cell surface receptors
   100654442 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRRCT LRR_1 PRIMA1
Other DBs
NCBI-GeneID: 100654442
NCBI-ProteinID: XP_003417572
UniProt: G3UL46
LinkDB
Position
Unknown
AA seq 783 aa
MLHSLWILWALGAIISLSKGGSSDQASLSCDPMGVCDGHSRSLNSIPSGLTAAVKSLDLS
NNEIVYVGNTDLQMCVNLKALILKSNEINRIDEDAFLPLGSLERLDLSYNYLSHLSSSWF
RPLSSLQFLSLLGNVYKELGETSLFSHLTNLRVLRVGNVYTSKIEKKDFAGITFLEELEI
DASNLQSYEPKSLKSIQNISHLILHMRQPILLPVTFVDLLNSLEYFELRDTDLHTFHFPE
LPVRETNPSIKKFTFRNVEITDESVNEVMTLFSYGSEFLELEFDDCTLNGIGNFDPSFME
KIKDPGKVETLIIRKLHIPQFYLFYDLSSIYALTGNVKKITIENSKVFLVPCSLSQHLKS
LEYLDLSENLMVEEYLKNSACEGAWPSLQTLILRQNHLTSLEKTGETLLTLKNLTSLDIS
KNSFKSMPETCQWPEKMKYLNLSSTQIDSLTYCIPRTLDILDVSNNNLNLFSLILPQLKE
LYISRNKLKTLPDSTFLPMLLVMKISGNTINTFSKEQLESLQNLKTLEAGGNNFICSCEF
LSLTQEQQALTQVLVDWPENYLCDSPSHVRGQRVQDTHLSVAECHRTALVSAVCCALLLF
ILLVVTLCYRFHGLWYMKMMWAWLQAKRKPKKAPNRDICYDAFVSYSERDSYWVENLMVQ
ELENFDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSH
FRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPNDEAQQQGFWLNLRTA
IKS
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgctacattctttgtggatactgtgggccttgggggccataatcagcctctccaaagga
gggtcctctgatcaggcttctctgtcctgtgaccctatgggtgtctgcgatggccactcc
aggtctttgaactccattccctcagggcttacagcagctgtgaaaagccttgacctgtcc
aacaatgagattgtgtatgtcggcaacactgacttgcagatgtgtgtgaacctcaaagct
ttgattctgaagtccaatgaaattaatagaatagatgaagatgcttttctgccccttgga
agtctcgaacgtttagacttatcctataattacttatctcatttatcatcctcctggttc
aggcccctttcttccttgcaattcttaagcttactgggaaatgtttacaaagaacttggg
gaaacatctcttttttctcatctgacaaacttgcgagtcttgagggtaggaaacgtttac
acctctaagattgagaaaaaggattttgctggaataacttttcttgaggaacttgagatt
gatgcttcaaatctccagagttatgagccaaaaagcttgaagtcaattcagaatataagt
catctgatccttcatatgagacagcctattttactgccagtgacttttgtagatctttta
aattccttggaatattttgaactgagagatactgatttgcacacttttcattttccagaa
ctacctgtcagggaaaccaatccatcgattaaaaagttcacatttaggaatgtagaaatc
actgatgaaagtgttaatgaagttatgacactgttcagttatggctctgaatttttagaa
ttagagtttgatgactgtacccttaatggaattggtaattttgatccatcttttatggaa
aaaattaaagatccaggtaaagtagaaacattaataatacggaagctacatattccacag
ttttacttattctatgatttgagtagtatatatgcactcacaggaaacgttaaaaaaatt
acaatagaaaacagcaaggtctttctggttccttgttcactttcacaacatttaaaatca
ttagaatacttggatcttagtgaaaatttgatggttgaagaatacttgaaaaattcagct
tgtgagggtgcctggccctccctacaaaccttaattttaaggcaaaatcatctgacatca
ttagaaaaaactggagaaactttgcttactctgaaaaacctgactagtcttgatatcagt
aagaatagttttaagtctatgcctgaaacttgccagtggccagaaaagatgaaatatttg
aacttatccagtacacaaatagatagtttaacctattgcattccccggacactggacatt
ttagatgttagcaataacaacctcaatttgttttctttgatcttgccacaactcaaagaa
ctttatatttccagaaacaagttgaagactctaccagattccaccttcttacccatgtta
ctagtcatgaaaatcagcgggaacacaataaatactttctctaaggagcaattggaatcc
cttcaaaacctgaagactttggaagcgggcggaaacaacttcatttgctcctgtgaattc
ctgtctttaactcaggagcagcaagcactgacccaggtcctggtcgattggccagaaaac
tacctgtgtgactctccatcccatgtgcggggccagcgagtgcaggacacgcacctctcg
gttgctgagtgccacaggacagccctggtgtctgctgtgtgctgtgcccttcttctgttc
atcctgcttgtggtgactttgtgctaccgtttccatgggctgtggtacatgaaaatgatg
tgggcttggctccaggccaaaaggaaacccaagaaggcacccaacagggacatctgttat
gacgcctttgtttcttatagtgagagggattcctactgggtcgagaaccttatggtccag
gagctggagaacttcgaccccccctttaagttgtgtctccataagcgggactttgttcct
ggcaagtggattattgacaatatcattgactccattgagaagagtcacaaaactgtcttt
gtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcccat
tttcgtctctttgatgagaacaatgatgctgccattctcattcttctggagcccattgag
aagaaagccattcctcagcggttctgtaaactgcggaagattatgaacaccaagacctac
ctggagtggcccaatgatgaagctcagcaacaagggttttggctaaatttgagaactgca
ataaagtcctag

DBGET integrated database retrieval system