KEGG   Loxodonta africana (African savanna elephant): 100654522
Entry
100654522         CDS       T04351                                 

Gene name
GPR119
Definition
(RefSeq) glucose-dependent insulinotropic receptor
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100654522 (GPR119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100654522 (GPR119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100654522 (GPR119)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    100654522 (GPR119)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx Fim-adh_lectin
Other DBs
NCBI-GeneID: 100654522
NCBI-ProteinID: XP_003414882
UniProt: G3U3B3
LinkDB
Position
Unknown
AA seq 335 aa
MESSFSFGVVLAVLASLIIAANALVAVVMMLLIHKNDGVGLCFTLNLAVADTLIGVAISG
LVTDQISSPARSTQKTLCSLRMAFVTSSSAASVLTVMLIAFDRYLAIKQPLRYFQIMSGL
MAGACIAGLWLVSYFIGFLPLGVPVFQQTTYQGPCSFFAVFHPRFVLTLFCVGFFPALLL
FVFFYCNMLKIASVHSQQIRKMEHAGAVARAYRPPRTPNDFKAIRTVAVLIGSFTLSWAP
FFITGIVQVACQGCHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRQQLYQMALGVKKG
LTSLLLLLSARNGGPEGPRESSCHIVTISHPQLDA
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggaatcatctttctccttcggagtggtccttgctgtcctggcctccctcatcattgct
gcaaatgcactagtggccgtggttatgatgttgctgattcacaaaaacgatggtgtgggt
ctctgcttcaccttgaatctggctgtggctgacaccttgattggcgtggctatctctggc
ttagtcacagaccagatttccagccctgctcggtccacgcagaagaccctgtgcagcctt
cggatggcatttgtcacttcctcctcagcggcctctgtcctcacggtcatgctgatcgcc
tttgacaggtaccttgccatcaagcagcccctccgctacttccagatcatgagtgggctc
atggctggggcctgcattgctgggctgtggttggtgtcttacttcattggcttcctccca
ctcggagtccctgtattccagcagaccacctaccaggggccctgcagcttctttgctgtg
tttcaccctcgcttcgtgctgaccctcttctgtgttggcttcttcccagccctgctcctc
ttcgtcttcttctactgcaacatgctcaagattgcctccgtgcacagccagcagatccga
aagatggagcatgcgggggccgtggctagagcttaccggcccccacggactcccaacgac
ttcaaggccatccgcactgtggctgttctaattgggagcttcactctgtcctgggccccc
ttctttatcaccggcattgtgcaggtggcctgccagggctgccacctctacctagtgctg
gaacggtacctgtggctcctcggtgtgggcaactccctgctcaacccactcatctatgcc
tactggcagaaggaggtgaggcagcagctctaccagatggccctgggagtgaagaaggga
ctcacctcactcctcctccttctctctgccaggaatggtggccctgaggggcctagggaa
agttcctgtcacatcgtcactatctcccacccacagcttgatgcctaa

DBGET integrated database retrieval system