KEGG   Loxodonta africana (African savanna elephant): 100654618
Entry
100654618         CDS       T04351                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04145  Phagosome
lav04210  Apoptosis
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04810  Regulation of actin cytoskeleton
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04971  Gastric acid secretion
lav05014  Amyotrophic lateral sclerosis
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05164  Influenza A
lav05205  Proteoglycans in cancer
lav05225  Hepatocellular carcinoma
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100654618 (ACTB)
   04390 Hippo signaling pathway
    100654618 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100654618 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    100654618 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100654618 (ACTB)
   04520 Adherens junction
    100654618 (ACTB)
   04530 Tight junction
    100654618 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100654618 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100654618 (ACTB)
   04613 Neutrophil extracellular trap formation
    100654618 (ACTB)
   04670 Leukocyte transendothelial migration
    100654618 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100654618 (ACTB)
   04919 Thyroid hormone signaling pathway
    100654618 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    100654618 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    100654618 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100654618 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100654618 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100654618 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100654618 (ACTB)
   05410 Hypertrophic cardiomyopathy
    100654618 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100654618 (ACTB)
   05414 Dilated cardiomyopathy
    100654618 (ACTB)
   05416 Viral myocarditis
    100654618 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654618 (ACTB)
   05135 Yersinia infection
    100654618 (ACTB)
   05100 Bacterial invasion of epithelial cells
    100654618 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    100654618 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100654618 (ACTB)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100654618 (ACTB)
   03036 Chromosome and associated proteins [BR:lav03036]
    100654618 (ACTB)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100654618 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100654618 (ACTB)
   04147 Exosome [BR:lav04147]
    100654618 (ACTB)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100654618 (ACTB)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100654618 (ACTB)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100654618 (ACTB)
    NuA4 complex
     100654618 (ACTB)
  Chromatin remodeling factors
   BAF complex
    100654618 (ACTB)
   PBAF complex
    100654618 (ACTB)
   SWR1 complex
    100654618 (ACTB)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100654618 (ACTB)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100654618 (ACTB)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100654618 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100654618
NCBI-ProteinID: XP_010594571
LinkDB
Position
Unknown
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggacgatgacatcgctgctctcgtggtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgacgccccccgggccgtcttcccttccatcgtggggcgcccccggcac
cagggtgtgatggtgggcatgggccagaaggattcctatgtgggcgacgaggcccagagc
aagagaggcatcctgaccctcaagtaccccattgagcatggtattgtcaccaactgggat
gacatggagaagatttggcaccacaccttctacaacgagctgcgtgtggcccccgaagag
caccctgtgttgctgactgaggcccccctgaaccctaaggccaatcgcgagaagatgacc
cagatcatgttcgagaccttcaacacccccgccatgtacgtggccatccaggccgtgctg
tccctgtatgcctctggccgtaccaccggcattgtgatggattccggcgatggggtcacc
cacactgtgcccatctatgagggctatgctctcccccacgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagatcctcacggagcgaggctacagtttc
accaccacggctgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgttgcc
ctggacttcgagcaggagatggccacggcggcctccagctcctccctggagaagagctat
gagctgcctgatgggcaggtcatcaccattggcaacgagcggttccgctgccccgaggcc
ctcttccaaccttccttcctgggaatggaatcctgtgggatccacgaaactacctttaac
tccatcatgaagtgcgacgttgacatccgcaaggacctctacgccaacacagtgctgtcc
ggcggtaccaccatgtacccgggtattgctgacaggatgcagaaggagatcacagcgctg
gcacctagcacaatgaagatcaagatcattgctcctcctgagcgcaagtactcagtgtgg
atcggcggttccatcctggcctcgctgtccaccttccagcaaatgtggattagcaagcaa
gagtacgatgagtccggcccctccatcgtccaccgcaaatgcttctag

KEGG   Loxodonta africana (African savanna elephant): 100670743
Entry
100670743         CDS       T04351                                 

Gene name
ACTG1
Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04145  Phagosome
lav04210  Apoptosis
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04520  Adherens junction
lav04530  Tight junction
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04810  Regulation of actin cytoskeleton
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04971  Gastric acid secretion
lav05014  Amyotrophic lateral sclerosis
lav05100  Bacterial invasion of epithelial cells
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05164  Influenza A
lav05205  Proteoglycans in cancer
lav05225  Hepatocellular carcinoma
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100670743 (ACTG1)
   04390 Hippo signaling pathway
    100670743 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100670743 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    100670743 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100670743 (ACTG1)
   04520 Adherens junction
    100670743 (ACTG1)
   04530 Tight junction
    100670743 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100670743 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100670743 (ACTG1)
   04613 Neutrophil extracellular trap formation
    100670743 (ACTG1)
   04670 Leukocyte transendothelial migration
    100670743 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100670743 (ACTG1)
   04919 Thyroid hormone signaling pathway
    100670743 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    100670743 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100670743 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100670743 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100670743 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100670743 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100670743 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    100670743 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100670743 (ACTG1)
   05414 Dilated cardiomyopathy
    100670743 (ACTG1)
   05416 Viral myocarditis
    100670743 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670743 (ACTG1)
   05135 Yersinia infection
    100670743 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    100670743 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    100670743 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lav03021]
    100670743 (ACTG1)
   03019 Messenger RNA biogenesis [BR:lav03019]
    100670743 (ACTG1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100670743 (ACTG1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100670743 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670743 (ACTG1)
   04147 Exosome [BR:lav04147]
    100670743 (ACTG1)
Transcription machinery [BR:lav03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100670743 (ACTG1)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100670743 (ACTG1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100670743 (ACTG1)
    NuA4 complex
     100670743 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    100670743 (ACTG1)
   PBAF complex
    100670743 (ACTG1)
   SWR1 complex
    100670743 (ACTG1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100670743 (ACTG1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100670743 (ACTG1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100670743 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100670743
NCBI-ProteinID: XP_003417431
UniProt: G3T386
LinkDB
Position
Unknown
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagagatcgccgccctggttatcgacaatgggtctggcatgtgtaaagctggc
tttgctggcgacgacgccccccgcgccgtcttcccctccatcgttggccgcccccggcac
cagggcgtcatggtgggcatgggccagaaggactcctacgtgggcgatgaggcccagagc
aagagaggcatcctgactctcaagtaccccatcgagcacggtattgtcaccaactgggac
gatatggagaagatttggcaccacactttctacaacgagctgcgtgtggcccccgaggag
cacccggtgttgctgactgaggcacccctgaaccccaaggccaacagggagaagatgacc
cagatcatgtttgagaccttcaacacgccagccatgtatgtggccatccaggcggtgctg
tccctgtatgcctctggccgaaccaccggtattgtcatggactctggcgatggtgtcact
cacactgtgcccatctacgagggctacgccctgccccacgccatcctgcgtctggacctg
gcaggccgagacctgactgactacctcatgaagatcctgaccgagcgagggtatagcttc
accaccacggctgagcgtgagattgtgcgtgacatcaaggagaagctgtgttacgtagcc
cttgacttcgagcaggagatggccacagccgcttcctcctcctctctggagaagagctat
gagctgccagacggccaggtgatcacaattggcaacgagcgtttccggtgtcccgaggcc
ctcttccagccctccttcctaggtatggagtcgtgcggcatccacgagaccactttcaac
tctatcatgaagtgtgacgtggacattcggaaggacctgtatgccaacacggtgctgtct
ggcgggaccaccatgtatcccggcattgctgacaggatgcagaaggagatcacagcgctg
gcgcccagcacaatgaagatcaagatcattgctccccctgagcgcaagtactcggtctgg
atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system