KEGG   Loxodonta africana (African savanna elephant): 100654706
Entry
100654706         CDS       T04351                                 

Gene name
JUNB
Definition
(RefSeq) transcription factor jun-B
  KO
K09028  transcription factor jun-B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04380  Osteoclast differentiation
lav04668  TNF signaling pathway
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100654706 (JUNB)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100654706 (JUNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100654706 (JUNB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100654706 (JUNB)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100654706 (JUNB)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB MAD DUF737 DivIC
Other DBs
NCBI-GeneID: 100654706
NCBI-ProteinID: XP_003413114
LinkDB
Position
Unknown
AA seq 347 aa
MCTKMEQPFYHDDSYAAAGYGRAPGGLALHDYKLLKPSLALNLADPYRGLKAAGARGPGP
EGSGGSSYFSSQGSDSSASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSSGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPPAGPGGVYAGPEPPP
VYTNLSSFSPASAPSGGAGAAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSNTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtgcactaaaatggaacaacctttctaccacgacgactcatacgcagcagcgggctac
ggccgggcccctggcggcctcgctctacacgactacaaactcctgaaacccagcctggcg
ctcaacctggccgacccctaccgaggccttaaagcggccggcgcgcggggccccggacca
gagggcagcggaggcagcagctacttttccagccagggctcggactcgagcgcttcgctc
aagctcgcctcgtcggagctagagcgcctgatcgtccccaacagcaacggcgtgatcacg
acgacgcccacgccaccgggacagtacttttacccccgcgggggtggcagcagcggaggt
gcagggggtgcagggggaggtgtcactgaggagcaggagggcttcgccgacggttttgtc
aaagccctggacgacctgcacaagatgaaccacgtgacgccccccaacgtgtctctgggc
gccagcggaggtcccccggccgggcccggaggcgtctacgcgggtccggagccgcctccg
gtctacaccaacctcagcagcttctccccggcgtctgcaccctctggcggcgccggggcc
gccgtcgggaccgggagttcgtatccgacggccaccatcagctacctcccacacgcgccg
ccgtttgccggcggccaccctgcgcagctgggcctgggccgtggcgcctccaccttcaag
gaggaaccacagacagtgccggaggcgcgcagccgcgacgccacgccgccggtgtccccc
atcaacatggaagaccaggagcgcatcaaagtggagcgcaagcggctgaggaaccgtctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacgctcaaggccgagaacgcggggctgtcgaacactgccggcctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgccagctgctgctc
ggggtcaaagggcacgccttctga

DBGET integrated database retrieval system