KEGG   Loxodonta africana (African savanna elephant): 100654730
Entry
100654730         CDS       T04351                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X2
  KO
K04735  transcription factor p65
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04071  Sphingolipid signaling pathway
lav04137  Mitophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04218  Cellular senescence
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04926  Relaxin signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100654730 (RELA)
   04014 Ras signaling pathway
    100654730 (RELA)
   04064 NF-kappa B signaling pathway
    100654730 (RELA)
   04668 TNF signaling pathway
    100654730 (RELA)
   04066 HIF-1 signaling pathway
    100654730 (RELA)
   04071 Sphingolipid signaling pathway
    100654730 (RELA)
   04024 cAMP signaling pathway
    100654730 (RELA)
   04151 PI3K-Akt signaling pathway
    100654730 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100654730 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100654730 (RELA)
   04218 Cellular senescence
    100654730 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100654730 (RELA)
   04621 NOD-like receptor signaling pathway
    100654730 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100654730 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100654730 (RELA)
   04625 C-type lectin receptor signaling pathway
    100654730 (RELA)
   04660 T cell receptor signaling pathway
    100654730 (RELA)
   04658 Th1 and Th2 cell differentiation
    100654730 (RELA)
   04659 Th17 cell differentiation
    100654730 (RELA)
   04657 IL-17 signaling pathway
    100654730 (RELA)
   04662 B cell receptor signaling pathway
    100654730 (RELA)
   04062 Chemokine signaling pathway
    100654730 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100654730 (RELA)
   04917 Prolactin signaling pathway
    100654730 (RELA)
   04926 Relaxin signaling pathway
    100654730 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100654730 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100654730 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100654730 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654730 (RELA)
   05202 Transcriptional misregulation in cancer
    100654730 (RELA)
   05203 Viral carcinogenesis
    100654730 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100654730 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100654730 (RELA)
   05221 Acute myeloid leukemia
    100654730 (RELA)
   05220 Chronic myeloid leukemia
    100654730 (RELA)
   05215 Prostate cancer
    100654730 (RELA)
   05222 Small cell lung cancer
    100654730 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100654730 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100654730 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100654730 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100654730 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100654730 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100654730 (RELA)
   04931 Insulin resistance
    100654730 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100654730 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654730 (RELA)
   05135 Yersinia infection
    100654730 (RELA)
   05133 Pertussis
    100654730 (RELA)
   05134 Legionellosis
    100654730 (RELA)
   05152 Tuberculosis
    100654730 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100654730 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100654730 (RELA)
   05162 Measles
    100654730 (RELA)
   05164 Influenza A
    100654730 (RELA)
   05161 Hepatitis B
    100654730 (RELA)
   05160 Hepatitis C
    100654730 (RELA)
   05168 Herpes simplex virus 1 infection
    100654730 (RELA)
   05163 Human cytomegalovirus infection
    100654730 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100654730 (RELA)
   05169 Epstein-Barr virus infection
    100654730 (RELA)
   05165 Human papillomavirus infection
    100654730 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100654730 (RELA)
   05145 Toxoplasmosis
    100654730 (RELA)
   05140 Leishmaniasis
    100654730 (RELA)
   05142 Chagas disease
    100654730 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100654730 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100654730 (RELA)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100654730 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100654730
NCBI-ProteinID: XP_010597340
LinkDB
Position
Unknown
AA seq 573 aa
MEDLFPLIFPSEPAQATGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVCFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFRSIMKKSPFNGPTDPRPPARRIAVPSRSSASIPKPAPQPYPFTPSLSTINF
EEFPPMIFSSGQIPSQAPAPVLAPAPAPAPAMASTLAPVPASTPAMASALAPAPAPAPAM
ASALAQAPTPGPVLAPSPAQAVGPPAPKTAQAGEGTLTEALLQLQFDADEDLGALLGHST
DPAVFTDLASVDNSEFQQLLNQGVSMAPHAAEPMLMEYPEAITRLVTGSQRAPDPVPAPL
GASGLANGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggaagatctgttccctctcatcttcccttcggagccggcccaggccaccggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgtttccgctacaagtgcgagggc
cgctcagcgggcagcatcccaggcgagaggagcaccgataccaccaagacccaccccacc
attaagatcaatggctacacagggccagggacagttcgcatctccctcgtcaccaaggac
ccccctcaccggcctcacccacacgagctcgtggggaaggactgtcgagatggcttctat
gaggctgagctctgcccagaccgctgtatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc
ttccaagtccccatagaggagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacggtgcgcgacccgtcaggcaggcccctccgcctgccgcctgtcctctct
catcccatctttgacaaccgcgcccctaatactgctgagctcaagatctgccgagtgaac
cgaaactctgggagctgccttggcggggatgagatcttcttgctgtgtgacaaggtgcag
aaagaggacattgaagtgtgtttcacgggaccaggctgggaggcccgaggctccttctca
caagccgatgtgcaccggcaagtggccatcgtgttccggacaccaccctatgcagatccc
agcctgcaggctcccgtgcgcgtctccatgcagctgcggcggccttccgatcgggagctc
agcgagcctatggaatttcagtacctgccagacacagatgatcgtcaccggattgaggag
aaacgcaagaggacatacgagaccttcaggagcatcatgaagaagagtcctttcaatgga
cccacggacccccggcctccagcccgacgcatcgctgtgccctcccgcagctcagcttcc
atccccaagccagccccccagccctacccctttacaccatccctcagcaccatcaacttt
gaggaattcccccccatgatcttttcttctgggcagatcccaagccaggccccagcccca
gtcctagccccggcaccagctcctgccccagccatggcatcaactctggccccggtgcca
gcttccaccccagccatggcatcagctctggccccggcgccagctcctgccccagccatg
gcatcagctctagcccaggccccaacccctggcccagtcctagccccaagccctgctcag
gctgtgggcccaccagcccccaagaccgcccaggccggggaagggacactgacagaggcc
ctgctacagctgcagtttgatgctgacgaagatctgggtgccctgctcggccacagcacg
gacccagctgtgttcacagacctggcatctgtcgacaactccgagtttcagcagctgctt
aaccagggtgtgtctatggccccccatgcagccgagcccatgctgatggagtaccctgag
gctataacccgcctggtgacagggtcccagagggcccctgacccagttcccgcccccctg
ggtgcctcagggcttgcgaacggcctcctctcaggggatgaagacttctcctccatcgca
gacatggacttctcagccctgctaagtcagatcagctcctaa

DBGET integrated database retrieval system