KEGG   Loxodonta africana (African savanna elephant): 100654735
Entry
100654735         CDS       T04351                                 

Gene name
LLGL1
Definition
(RefSeq) lethal(2) giant larvae protein homolog 1 isoform X2
  KO
K06094  lethal(2) giant larvae protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100654735 (LLGL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100654735 (LLGL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100654735 (LLGL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100654735 (LLGL1)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100654735 (LLGL1)
SSDB
Motif
Pfam: LLGL Lgl_C WD40
Other DBs
NCBI-GeneID: 100654735
NCBI-ProteinID: XP_010598531
LinkDB
Position
Unknown
AA seq 984 aa
MHFLPGQGRLLTLLDDNSLHLWEIVPHNGCAHLEETLSFQPPSRPSFDGTSTLPSLSRVT
VVLLVDAGDRAALGTEGGSVVFLNVDTLTLLEGQTLAPDEVLRSLPDDCRCGKALGPVES
LQGHLQDPNKILIGYSRGLLVIWSQTARCVERVFLGNQLESLCWERSGSTVVSSHSDGSY
AVWPADLGSTLVLQPTAATTPYGPFPCKAINKILWRSCESGGHFIIFSGGMPRASYGDRH
CVSVLRAETLVTLDFTSRVIDFFTVHSTRPEDEFDDPQALAVLLEEELVVLDLQTPGWPA
VPAPYLAPLHSSAITCSAHVANVPAKLWARLVSLGEQQSPQPTSSASSWPITGGRNLAQE
PSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDFEHTDSLVQAAEDDWPPFR
KVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPTEQAVSVASMDLLQ
DREGFTWKGHDRLSPSTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWGLVAFGTSHGF
GLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAVNA
SSKLQEANAQLAEQACPHDVEVTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDAVHHGP
TLWAGTNSGSVFAYALEVPVVTTGSEKRPERAVEAVLGKEVQLMHRAPVVAIAVLDGRGR
PLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVA
LATFASVVCEDYTETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDISGIASCVFTRHG
QGFYLISPSEFERFSLSARNITEPLCSLDIRWPRSTTCDSYRLQESPKLSQANGTPGIIL
APRSCDRSPSPARSKGAGDTLEPSEATLSPMSVDSATSADTTLDTTGDVTMEDVKDFLSS
SEEPQKNLRNVAQDEARACTILIK
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgcatttcctgcctggccagggtcgcctcttgaccctgctggacgacaacagcctgcat
ctctgggagatcgtccctcacaatggctgtgcccacctggaggaaacactcagcttccag
ccaccaagccgccccagttttgatggcaccagcaccctgcccagcctctcccgtgtcact
gtggtcctgctggtggatgctggcgacagggcagcccttggcactgagggtggcagcgtc
gtcttcttgaacgtggacacattgacactgcttgaggggcagacccttgcccctgacgag
gttctgcgaagcctgccggatgactgccgatgtgggaaggctctgggccctgtggagtct
ctccaggggcacctgcaggaccccaacaagatcctcataggctacagccggggcctgttg
gtcatctggagccagactgcacgctgcgtggagcgcgtcttcttgggcaaccagctggag
agcctgtgctgggagcgaagcggcagcaccgttgtcagctcccacagcgatggcagctac
gccgtctggcctgcagacttgggcagcaccctggtgctgcagcccacagcagccaccacg
ccctatggtcccttcccctgcaaagccatcaacaagattctgtggcgaagctgtgaatca
gggggtcactttatcatcttcagtggtggcatgccccgcgccagctatggggaccgccac
tgtgtgagcgtacttcgagctgagaccctggtgaccttggacttcacctcccgcgtcatc
gacttcttcacggtgcacagcacgcggcccgaggatgaatttgatgacccccaggctctg
gctgtgctgcttgaagaggagctggtggtactggacctgcaaacacccggctggccggcc
gtacctgccccatacctcgcccctctgcactcatccgccatcacctgctcggcccacgtt
gccaacgtccctgccaagctgtgggcccgcctcgtgagcttgggggagcagcagagcccg
cagcctacctccagtgcctcgagctggcccattactgggggccggaacctggcccaggag
ccatcacagcgggggctgctgctgaccggccatgaggatggcactgtgcgcttttgggac
gcctcgggcgtggcactgcggcccctctacaagctgagcacagctggcctgttccagacg
gactttgagcacactgacagcctggtccaggctgccgaggacgactggccaccctttcgc
aaggtgggctgctttgacccctacagcgacgacccccggctcggtgtgcagaaggtggca
ctttgcaagtacacagcccagatggtggtggccgggactgcgggccaggtgctggtgctg
gagctgagtgatgtgccgactgagcaggcagtcagtgtggccagcatggacctcctccag
gaccgcgagggcttcacatggaaaggccacgaccggctgagccccagcacagggccactg
ccctggcccgctggcttccagccccgagtgctggtgcagtgcctgccgcctgctgccgtc
acagctgtcacgctgcacactgagtggggcctcgtggcctttggcactagtcatggcttt
ggtctctttgactaccagcgcaagagccctgtgctggccaggtgcacccttcaccccaac
gactctctggctatggaggggccgctctcacgggtgaagtcactcaagaagtcactgcgt
cagtcttttcggcgcattcgcaagagccgggtgtctggcaagaagcgggctgtcaacgcc
agcagcaagttgcaggaggccaacgcgcagctggcggagcaggcctgcccccacgacgtg
gaggtgacaccagtgcagcgccgcatcgagccccgctcagctgacgactccctctccggt
gtggtgcgctgcctctacttcgctgacacattccttcgtgatgctgtccaccatggcccc
accctgtgggctggcaccaactcaggctccgtgtttgcctacgcgctggaggtgccagtg
gtgacgacgggcagcgagaagcggccggagcgggcagtagaggctgtgctcggcaaggag
gtgcagctgatgcatcgagcgcctgtggtggccattgctgtgctggatgggcgtggccgc
ccactgcctgagccttatgaggcctcccgggacctggcacaggcccccgacatgcagggc
ggccatgctgtgcttatagcatctgaggagcagttcaaggtgttcacactgcccaaggtg
agtgccaagaccaagttcaagctgacagcccacgagggctgccgcgtgcgcaaggtggca
ctggccacgtttgccagtgtggtctgcgaggactatactgagacctgcctggcctgcctc
accaacttgggtgatgtccacgtcttctcggtgcctggcctgcggccccaggtgcactat
tcctgcatccggaaggaggacatcagcggcatcgcctcctgtgtcttcacgcgccacggc
cagggtttctacctgatttccccgtctgagtttgaacgcttttccctcagtgctcggaac
atcacagagccgctgtgctccctggacattcgctggccccgcagcactacctgtgacagc
tacaggctccaagagtcacccaagctgagccaggccaacgggaccccaggcatcatcctg
gccccacggagctgtgacaggagccccagccctgcccgaagcaagggagccggggacact
ctggagccatctgaggccacactttcgcccatgtctgtggactcagccaccagtgccgac
accacgctggacaccacaggggatgttactatggaggacgtgaaggatttcttgagctct
tcagaggaaccacagaagaatctgaggaacgtggcgcaagatgaggcccgtgcctgcacc
attctgatcaaatga

KEGG   Loxodonta africana (African savanna elephant): 100672463
Entry
100672463         CDS       T04351                                 

Gene name
LLGL2
Definition
(RefSeq) LOW QUALITY PROTEIN: lethal(2) giant larvae protein homolog 2
  KO
K06094  lethal(2) giant larvae protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100672463 (LLGL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100672463 (LLGL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100672463 (LLGL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100672463 (LLGL2)
Membrane trafficking [BR:lav04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100672463 (LLGL2)
SSDB
Motif
Pfam: LLGL WD40 Lgl_C
Other DBs
NCBI-GeneID: 100672463
NCBI-ProteinID: XP_023412659
LinkDB
Position
Unknown
AA seq 1020 aa
MRRFLRSGPDPERERLKRELFQFNKTVEHGFPHQPSALGYSPSLRLLAIGTRSGAIKLYG
APGVEFMGLHRENNAVVQIHFLLGQCQLVTLLDDNSLHLWSLKVKAGVSELQEEESFTLR
SPPGAAPSATQITVVLPHSSRELLYLGTESGDVFVVQLPAFRALEDKTVSSDAVLQRLPE
EARHRRVFEMVEALQEHPRDPNQILVGYSRGLVVVWDLRGSRVLYHFLSSQQLENVCWQR
DGCLIVSCHSDGSYCQWPVSGDVQQPEPLPSYMPYGPFPCKAITKIFWLTTKKGLPFTIF
QGGMPRASYGDRHCISVIHGSQQTAFDFTSRVIDFTVLAEADPTAAFDDPYALVVLAEEE
LVVIDLKVAGWPLVQPPYLASLHCSAITCSHHVSNIPLKLWERVITAGSRQSTQFSSMEW
PIDGGTNLAPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVPVFLTDADPNESLH
TQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEH
TVEQVEADLLQDQEGYRWKGHERLXCRRGPVHFEPGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLVDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRIRRS
RASTRKRRPAGLPGEVPEAKTERAGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTY
LRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRMDEPVRAEQTKEIQLMHRAPVVGILVL
DGHSVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTALEGSR
VRRVSVAHFGSCRTEDYGEHHLAVLTNLGDVQVVSLPLLKPQVRFSCIRREDVSGIASCV
FTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVESAETKNHSCPHNGAGHEKAVGRARNS
GSQSDGEERMPGPVMEHALLNDERVLKEIQSTLEGDRASYGDWHSRRMAVGYSLSNGGAE
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgaggcggttcctgcggtcaggccctgacccagagcgagagaggcttaagcgggaactc
ttccagttcaacaagaccgtggagcatggcttcccgcaccagcccagcgccctcggctac
agcccctcactgcgcttgctggccattggcactcgctctggagccatcaagctctacggc
gcccctggggtagaattcatgggactgcatcgtgagaacaacgccgtggtgcagatccac
ttcctgcttggacagtgccagctggtcaccctcttggacgacaacagcctgcatctctgg
agcctgaaggtcaaggctggggtctcggagctgcaggaggaggagagctttacactgcgc
agccccccgggggccgcccccagtgccacacagatcactgtggtcctgccacactcctcc
cgtgagctgctgtacctgggcactgagagtggtgacgtgtttgtggtgcagctgccggcc
ttccgcgcgctagaggacaagactgtcagctcagacgccgtgctgcagcggttgccagag
gaggcccgtcaccggcgggtgtttgagatggtggaggccctgcaggagcaccctcgagac
cccaatcagatcctggtcggctatagccggggcctcgtcgttgtctgggacctgcggggc
agccgtgtgctctaccacttccttagcagccagcaactggagaacgtctgctggcagcgt
gatggctgtctgattgtcagctgccattctgacggcagctactgccagtggcccgtgtct
ggtgatgtccagcaaccagagcccttgcccagctacatgccttacggtccctttccttgc
aaagctattaccaaaatcttctggctgactaccaagaaggggttgcccttcaccatcttc
cagggtggcatgccaagggccagctatggggaccgccactgcatctcggtgatccatggc
agccagcagacggcctttgacttcacctcccgtgtcattgacttcacggtcctcgccgag
gcggaccccacggctgcctttgacgacccctacgccctggtggtgctggccgaggaggag
ctggtggtgattgacctgaaggtggccggctggccactagtgcagccaccctacctggct
tccctgcactgctccgccatcacctgctcccaccacgtctccaacatccccctgaagctg
tgggagcgcgtcatcactgccggcagccggcagagcacgcagttctccagcatggagtgg
cccattgatgggggcaccaacctggccccagccccaccccagagggacctgctgctcacg
gggcatgaggacggcactgtgcggttctgggatgcctcgggcgtctgcttgcggctcctc
tacaagctcagcaccgtaccagtgttcctcactgatgcggaccccaatgagagcctccac
actcagggcgaggatgagtggcccccactacgcaaggtgggctctttcgacccctacagt
gatgaccctcggctgggcatccagaagattttcctctgcaaatacagcggctacctggct
gtggcgggcacagcagggcaggtgctggtgctggagctgaacgacgaggctgcggagcac
acagtggagcaggtagaggcagacctgctgcaggaccaggagggctaccgctggaagggg
cacgaacgcctgntgtgccgccgggggcctgtgcacttcgaacccggcttccagcctttt
gtgctggtgcagtgccagcccccggccgttgtcacctccctggccctacattccgagtgg
cggctcgtggcctttggcaccagccatggcttcggcctcgtcgaccaccagcagcggcgg
caggtctttgtcaagtgcacgctgcatcccagtgaccagctggccttggagggccccctg
tcccgtgtgaagtccctgaagaaatccctgcgccagtcattccgccggatacgccgcagc
agggcatccacccggaagcggcggccagctggcctcccaggagaggtgccagaggccaag
acagagcgcgctggcctgcagaacatggagctggcacctgtgcagcgcaagatcgaggcc
cgctcggccgaggactccttcaccggctttgtccgcaccctctactttgccgacacctac
ctgagggacagctcccgccactgcccgtcactgtgggctggcaccaatggcggtactgtc
tacgccttctccctgcgcgtgccccctgccgagcggaggatggatgagcccgtgcgggca
gagcagaccaaggagatccagctgatgcaccgtgcacctgtggtgggcatcctagtgctg
gacggacacagcgtgccccttccagagcccctggaggtggcccacgacctgtcaaagagc
ccagacatgcaaggaagtcaccagctactggttgtgtcggaggagcagttcaaggtgttt
acactacccaaggtcagtgccaagctgaagctgaagctgacggccctggagggctcgcgg
gtgcggcgggtcagcgtggcccacttcggcagctgtcgaactgaggattatggggagcat
cacctggctgtcctcaccaacctgggcgacgtccaggtggtctcgctgcccctgctcaag
ccccaggtgcgcttcagctgcatccgccgggaggatgttagtggcatcgcctcctgtgtc
ttcaccaaatatggccaaggtttctacctgatctccccctcggagtttgagcgcttctct
ctctccactaagtggctggttgagccccggtgtctggtggaatcagcagaaaccaagaac
cacagttgcccccacaatggggcgggccatgagaaggctgtgggccgagccaggaactca
gggagccagagtgatggagaggagaggatgccaggccccgtgatggagcacgcgctgctc
aatgacgagagagtgctgaaggagatccagagcacactggagggagaccgagcgagctat
ggggattggcattcccggagaatggcggtggggtacagcctcagcaatggaggagcagag
tga

DBGET integrated database retrieval system