KEGG   Loxodonta africana (African savanna elephant): 100654759
Entry
100654759         CDS       T04351                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04640  Hematopoietic cell lineage
lav04916  Melanogenesis
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100654759 (KITLG)
   04014 Ras signaling pathway
    100654759 (KITLG)
   04015 Rap1 signaling pathway
    100654759 (KITLG)
   04072 Phospholipase D signaling pathway
    100654759 (KITLG)
   04151 PI3K-Akt signaling pathway
    100654759 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100654759 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100654759 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654759 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100654759 (KITLG)
Cytokines and growth factors [BR:lav04052]
 Growth factors
  Growth factors (RTK binding)
   100654759 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 100654759
NCBI-ProteinID: XP_010597500
LinkDB
Position
Unknown
AA seq 273 aa
MKKTQTWIFTCIYLQLLLFNPLVKTKGICGNRVTDDVKDVTKLVANLPKDYKISLKYVPG
MDILPSHCWISEMVRQLTFSLTELLSKFSSISEGLSNYSIIDKLVKIVDDLVECVEDHSS
THVIRGSKNPEPRLFTPEEFFSIFNRSIDAIKDFRVTSETSDCVLSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAENSIGDSSLQWAAMALLAFFSLVIGFAFGAFYWKKK
QPNLTRAVENTQINEEDNEISMLQEREREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattttcacttgcatttatcttcagctgctcctgtttaat
cctctcgtcaaaactaaagggatctgtgggaatcgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagatatccctcaagtatgttcccggg
atggacattttgcccagtcattgttggataagtgaaatggtgagacagttgacgttcagc
ttgactgagcttctgagcaagttttcaagtatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaagatagtggatgatctggtggagtgcgtggaggaccactcatct
acgcatgtaataagaggatctaagaacccagaacccaggctatttactcctgaagaattc
tttagcattttcaatagatccatagatgccattaaggactttagggtgacatcagaaaca
agtgattgtgtgctttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggctgaaaattccattggtgactccagcctacaatgggcagccatggcattg
ctagcgttcttttctcttgtaattgggtttgcttttggagccttctactggaagaagaaa
caaccaaatcttacaagggcagttgaaaatacacagatcaatgaagaggataatgagata
agtatgttgcaagaaagagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system