KEGG   Loxodonta africana (African savanna elephant): 100654811
Entry
100654811         CDS       T04351                                 

Gene name
TRPC1
Definition
(RefSeq) short transient receptor potential channel 1 isoform X1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04360  Axon guidance
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04929  GnRH secretion
lav04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100654811 (TRPC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100654811 (TRPC1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100654811 (TRPC1)
   04726 Serotonergic synapse
    100654811 (TRPC1)
  09158 Development and regeneration
   04360 Axon guidance
    100654811 (TRPC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100654811 (TRPC1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100654811 (TRPC1)
SSDB
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4 DUF2157
Other DBs
NCBI-GeneID: 100654811
NCBI-ProteinID: XP_023411221
LinkDB
Position
Unknown
AA seq 772 aa
MFVYCYLGDYYMVKKILEENCSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQY
SSPGHFALPHPRGCLELPGDIVRFHSYKSTDALLVAIDSEVVGAVDILLNHRPKRSSRPT
IVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAK
NKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFSNDYEEL
AQQCKTFAKDLLAQARNSRELEVILNHTSNDEPLDKRGLLEERMNLSRLKLAIKYNQKEF
VAQSNCQQFLNTVWFGQMSGYRRKPTCKKIVTVLTVGVFWPVLSLCYLIAPKSQFGRIIH
TPFTKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIFGMIWSDIKR
LWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHSKFHDFADRKDWDAFHPTLVAEGL
FAFANVLSYLRLFFMYTTSSILGPLQISMGQMLHDFGKFLGMFLLVLFSFTIGLTQLYDK
GYTPKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFV
GAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPP
FNIVPSPKTICYIVSSLRKWICSHTSKGRVKRQNSLKEWRNLKQKRDENYQKVMCCLVHR
YLTSMRQKMQSTDQATVESLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtttgtatattgttatttaggtgactattatatggttaaaaagattttggaggaaaac
tgttcaggtgacttgaacataaattgcgtagatgtgcttgggagaaacgctgttaccata
actattgaaaacgaaaacttggatattctacagcttcttttggactacggttgtcagtac
tcctcacctgggcattttgccctgccccacccaaggggttgtttggaattgcctggagac
attgttcgttttcacagctacaagtccacagatgcacttttggtggcaatcgactctgaa
gtagtgggagctgttgatatactacttaatcatcggccaaaacgatcatcaagaccaact
atagtaaaactaatggaaagaattcagaatcctgaatattcaacaacgatggatgttgca
cctgtcattttagctgctcatcgtaacaactacgaaattcttacaatgctgttaaagcag
gatgtgtctctacccaagccccatgctgttggctgtgaatgcacgttgtgttctgcaaaa
aacaaaaaggacagcctccgacattccaggtttcgtcttgatatttatcgatgcttggcc
agtccggctctaataatgttaacagaggaggatccaattctgagagcatttgaacttagt
gcagatttaaaagaactaagcctcgtggaggtggaattcagcaatgattatgaggagcta
gctcagcaatgtaaaacgtttgctaaagatttgcttgcacaagcccggaattcccgcgaa
ttggaggtgatcctaaaccatacatctaatgatgagcctcttgacaaacggggattacta
gaagaaagaatgaatttaagtcgtcttaaacttgctataaaatataaccaaaaggagttt
gtcgcccagtctaactgccagcagtttctgaacaccgtttggtttggacaaatgtcaggt
taccgacgtaagcccacctgtaagaagatagtgactgttttgacagttggcgtcttttgg
cctgttttgtcactttgttatttgatagctcccaaatctcaatttggtagaatcattcac
acaccttttacgaagtttattattcacggagcatcatatttcacgttcctgctgttacta
aacctgtactctcttgtctacaatgaggataagaaaaacacaatggggccagcccttgaa
agaatagactatcttcttatactgtggatttttgggatgatttggtcagacattaaaaga
ctctggtatgaagggttggaagactttttagaagaatctcgtaatcaactcagttttgtc
atgaattccctttatttggcaacgtttgccctcaaagtggttgctcatagcaagtttcat
gactttgctgatcggaaggactgggatgcgttccatcccacactggtggccgaagggctt
tttgcatttgcaaacgttctgagttatcttcggctcttttttatgtatacgaccagctct
atcttgggtccattacagatttcaatgggacagatgttgcatgattttggaaaatttctt
gggatgttccttcttgtcttgttttctttcacaattggcctgacccagctgtatgataaa
ggctatactccaaaggagcagaaggactgcgtcggcatcttctgtgaacagcaaagcaat
gatacctttcactcgttcattggcacttgctttgccttgttctggtatattttctcccta
gcgcatgtggccatctttgtcacaaggttcagctatggagaagagctgcagtccttcgtt
ggagctgttatcgttggcacctacaacgtggtggttgtgatcgtgcttacgaagctgctg
gtggcgatgcttcacaaaagctttcagttgatagcaaatcatgaagacaaagaatggaag
tttgctcgagcaaagttgtggcttagctactttgatgacaaatgtaccttacccccgcct
ttcaacatcgttccttccccgaagactatctgctatatcgtgagtagcctcaggaagtgg
atttgttctcatacatcaaaaggcagggtcaaacggcaaaacagcttaaaggaatggaga
aatttgaaacaaaagagagatgaaaactaccaaaaagtgatgtgctgtttagtacatcgc
tacctgacttccatgagacagaagatgcaaagtacagatcaggcaactgtggaaagttta
aatgaactacgccaagatctgtcaaaattccgaaatgaaatacgggatttacttggcttt
cggacttcaaaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system