KEGG   Loxodonta africana (African savanna elephant): 100654838
Entry
100654838         CDS       T04351                                 

Gene name
DLL1
Definition
(RefSeq) LOW QUALITY PROTEIN: delta-like protein 1
  KO
K06051  delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav05200  Pathways in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100654838 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100654838 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654838 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    100654838 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100654838 (DLL1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA EGF_3 EGF_2
Other DBs
NCBI-GeneID: 100654838
NCBI-ProteinID: XP_023396830
LinkDB
Position
Unknown
AA seq 787 aa
MGRPCTLALAVVSALLCQVWSSGVFELKLQEFVNKKGPLGNRNCCRSAAGGAGPPQCECR
TFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGGGHAAFSNPIRFPFGFTW
PGTFSLIIEALHTDSPDDLTTENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYAYR
FVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTERESLPQGWRPPTI
SSLWASTGEVRDLHTCVRVCDQCFLSSRCRVGWQGRYCDQCIRYPGCLHGTCQQPWQCNC
QEGWGGLFCNQDLNYCTHHKPCENGATCTNTGQGSYTCSCRPGYTGANCESEIDECDAGP
CKNGGSCTDLENSYSCTCPPGFYGKHCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPVG
YSGFNCEKKIDYCSSSPCSNGAQCVDLGSSYLCRCPAGFSGQHCDGNVDDCASLPCVNGG
TCQDGVNDYSCTCPPGYTGKNCSAPVSRCEHGPCHNGATCHERGRRYVCECARGYGGPNC
QFLLPEPGPVVVDLTERYLEAPGGQFPWIAVCAGVVLVLLLLLGCAAVGVCVRLKVQKRQ
LLGDACRAEAETMNNLASCHREKDVSVSVIGSPQVKNTNKKADVHGDHGTDKGGFKARYP
AVDYNLVQDLKNEDPARDTHSKREARPEPHSCMGMEKGPAMLKGGEASERKRPDSTYSLS
KDTKYQSVYVVSEKDECVIATEVGVGLLLGHRACCGACQGVGESGHRSLRLGFGVLGPGV
GFSVELL
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgggccgtccgtgcacactggccctcgccgtggtctcggccctactgtgccaggtctgg
agctcaggggttttcgagctgaagctgcaggagttcgtcaacaagaaggggcctctgggg
aaccgcaattgctgccgcagcgcggcggggggcgcggggccaccgcaatgcgagtgcagg
accttcttccgcgtgtgcctcaagcattatcaggccagtgtgtccccggagccgccctgc
acctacggcagcgccgtcacgcccgtgctgggcgttgactccttcagcctgcctgacggc
gcgggtggcggccacgcggccttcagcaatcccatccgcttccccttcggcttcacctgg
ccgggcaccttctctctgatcattgaagctctccacacggattctccggatgacctcaca
acagaaaacccggagcggctcatcagccgcctggccacgcagcggcacctgacggtgggc
gaggagtggtcccaggacctgcacagcagcggccgcacggacctcaagtacgcctaccgc
ttcgtgtgtgacgagcactactacggggagggctgttctgtcttctgccgcccccgggac
gacgcgttcggccacttcacctgcggggagagaggagagaaagtctgcaaccccggctgg
aagggccagtactgcaccgagcgtgagtctctgccccagggctggcggcctcccacgatt
agctctctctgggccagcacgggcgaggtccgggatctccacacgtgtgtgcgcgtgtgc
gaccagtgcttcctgtcctccaggtgcagggtcggctggcagggtcggtactgtgaccag
tgcattcggtaccctggctgcctccacggcacctgccagcagccgtggcaatgcaattgc
caggagggctggggtggcctcttctgcaaccaggatctgaactactgcacccaccacaag
ccctgtgagaacggagccacctgcaccaacacgggccagggcagctacacctgctcctgc
cggcccgggtacacgggcgccaactgtgagagcgagatcgatgagtgcgatgctggcccg
tgtaagaacggaggaagctgcacggatcttgaaaacagctactcatgcacctgcccacct
ggcttctacggcaagcactgtgagctgagtgcaatgacctgtgctgacggcccttgtttc
aatggggggcggtgctcagacaaccctgatgggggttacacctgccactgcccggtgggc
tactctggctttaactgcgagaagaagatcgactactgcagctcttcaccttgctccaat
ggggcgcagtgtgtggacctgggcagctcctacctgtgccggtgcccggctggcttctcg
gggcagcactgcgacggcaacgtggacgactgtgcgtccctaccctgtgtcaacggcggc
acctgtcaggacggtgtcaacgactactcctgcacctgccccccagggtacacgggcaag
aactgcagtgccccggtcagcaggtgcgagcacgggccctgccacaatggggccacctgc
cacgagaggggccggcgctatgtctgtgagtgcgctcgtggctacggcggccctaactgc
cagttcctgctgcccgagccggggcctgtggtggtggacctcactgagcgctacctggag
gccccgggtgggcagttcccatggattgccgtctgtgccggtgttgtgctggtgctgctg
ctgttgctgggctgtgcggccgtgggcgtctgcgtgcggctgaaggtacagaagcggcag
ctgctgggggatgcgtgccgggcagaggcggagaccatgaacaacctggccagctgccat
cgtgagaaggacgtgtcggtcagtgtcatcgggtccccccaagtcaagaacaccaacaag
aaggcggatgtgcacggtgaccatggcaccgacaagggtggcttcaaggcccgctaccct
gctgtggactacaacctggtgcaggacctcaagaatgaggaccctgccagggatacccac
agcaagcgtgaggccaggcccgagccccacagctgcatgggcatggagaagggacctgca
atgctgaagggtggggaagcatcagaacggaaaaggccggattccacgtactccttgtcg
aaagacaccaagtaccagtcggtgtacgtcgtctcagagaaggatgagtgtgtcattgct
actgaggttggtgtggggcttctgttggggcatcgggcttgctgtggggcttgtcagggt
gttggcgagtcagggcatcggtcattgaggcttggtttcggggtgttgggccccggggtg
gggttcagtgtggaactcttgtag

KEGG   Loxodonta africana (African savanna elephant): 100662144
Entry
100662144         CDS       T04351                                 

Gene name
DLL3
Definition
(RefSeq) delta-like protein 3
  KO
K06051  delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav05200  Pathways in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100662144 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100662144 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100662144 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    100662144 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100662144 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 EGF_CA DSL
Other DBs
NCBI-GeneID: 100662144
NCBI-ProteinID: XP_023395609
LinkDB
Position
Unknown
AA seq 472 aa
MPGFTQSQGTFSLIIEIWKEELGEEIAGAAWSLLSRVAGRWRLEAGSPWARDVQRAGGWE
LRFSYRARCEPPAVGAACTRLCRSRSAPSRCGPGQRPCAPMEEDCAAPLACRAGCSPEHG
FCEQPNECQCLEGWAGPLCTVPVSTSSCLSPRGPSSATAGCLIPGPGPCDGNPCANGGSC
SETPGSFECACPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYVCHCPPGFQGSN
CEKRVDRCSLQPCRNGGLCLDLGYALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCLEG
GGARRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVR
PDGAEDGAGAPHAAPPGPRQGDPQRFLLPPALGLLVAASFAGAVLWLIHLRRRGSGRDTG
SRLLAGTPEPPTHSLPDALNNMRIREDPGDGPRPDLPLRHHLLETDLGYFCI
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgcctggattcacacaatctcagggtaccttttctctcatcattgaaatctggaaagaa
gaactaggagaggagattgcaggagcagcctggagcttgctgtcgcgcgtggccggacgg
tggcgcctggaggctgggagcccgtgggccagggacgtgcagcgcgcaggcggctgggag
ctgcgcttctcgtaccgcgcgcgctgcgagcctcccgccgtcggggccgcgtgcacgcgc
ctctgccgttcgcgcagcgccccctcgcggtgcggcccgggacagcgcccatgcgctccc
atggaggaggactgcgcggcaccactggcatgtcgagcaggctgcagcccggagcatggc
ttctgtgagcaacccaatgaatgtcaatgcctggagggatgggctgggcccctctgcaca
gtcccagtctccaccagcagctgcctcagccccaggggcccatcctctgccacagctggg
tgcctcatacccgggcctgggccctgtgacgggaacccgtgtgccaacgggggcagctgt
agtgaaacaccaggttccttcgagtgcgcctgcccccgtgggttctacgggcttcggtgt
gaggtgagcggggtgacatgcgcggatggaccctgcttcaatggcggcttgtgtgtgggg
ggcgcagaccccgactctgcctacgtctgccactgcccgcccggcttccagggctccaac
tgcgagaagagggtagaccggtgcagcctgcagccgtgccggaatggcgggctctgcctg
gacctgggctatgccctgcgctgccgctgccgtgcgggcttcgcgggcccacgctgcgag
cacgacctggatgactgcgccgggcgcgcctgcgctaacggcggcacgtgcctggagggc
ggtggcgcgcgccgctgctcctgcgcgctgggcttcggcggccgcgactgccgcgagcgc
gccgacccgtgcgccgcgcgcccctgcgcgcacggcggccgctgctacgcccacttctcc
ggcctcgtctgcgcctgcgcgcccggctacatgggggcgcggtgcgagttcccggttcgc
cccgacggtgcggaggacggcgcaggcgcaccgcacgcggccccaccgggccccaggcag
ggggatccgcagcgcttccttttgccgccagctttgggcttgttggtggccgcaagcttt
gccggcgctgtgctctggctgatccacttgcgacgccgtggctctggccgggatactggg
tctcgcctgttggcggggaccccggagccaccaacccactcactccccgatgctctgaac
aacatgcgtatacgagaggaccccggggatggcccgaggcctgacctgcctcttcgccat
catctcttggagacagatcttggatatttttgtatttag

KEGG   Loxodonta africana (African savanna elephant): 100671694
Entry
100671694         CDS       T04351                                 

Gene name
DLL4
Definition
(RefSeq) delta-like protein 4
  KO
K06051  delta
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav05200  Pathways in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100671694 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100671694 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671694 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    100671694 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100671694 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 100671694
NCBI-ProteinID: XP_010596654
UniProt: G3TDT5
LinkDB
Position
Unknown
AA seq 685 aa
MAGATRSASGWILLLLVALWQQRAAGSGVFQLQLQEFANEHGVLASGRSCEPRCRTFFHV
CLKHFQAVVSPGACTFGSVSTPVLGTNSFAVGDDSRGGGHNPLQLPFNFTWPGTFSLIIE
AWHALGNDLRPEALPADALISRITIQGSLAVGENWLLDEQSRSLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGKYCDQPICLSGCNEQNGYCIKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQKDGYLCQCPPGYYGLHCE
RSTLSCTDSPCFNGGSCQERNQGSSYACECPPNFTGSNCEKKVDRCTINPCANGGQCLNR
GPNSLCRCRPGFTGARCELPISSCARSPCAHGGTCHDLENGLLCTCPPGFSGQRCEVRTP
SDACASGPCFNGATCYTGLSLDSFICNCPYGFLGSRCEIPVDLPPSFPWVAVSLGVGLVV
VLVLLGMVAVAVRQLRLRRPDDDSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGLLGRGTIPGKYPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggctggcgcgacccggagcgcctctggctggattctactgctgctggtggcactttgg
cagcagcgcgcggctggctccggcgtcttccagctgcagctgcaggagttcgccaacgag
cacggtgtcctagccagcgggcggtcgtgcgagccccgctgccggaccttcttccacgtc
tgccttaagcattttcaggcggtcgtctctcccggggcctgcaccttcggcagcgtctcc
acaccggtgttgggcaccaactccttcgcggtcggggacgacagtagaggcggaggccac
aatcctctccaactgcccttcaatttcacctggccgggcaccttctcactcatcatcgaa
gcttggcacgcgctgggaaacgacctgcgcccagaggccttgccagcagatgcactcatc
agcaggatcaccatccaggggtccctagctgtgggcgagaactggctgctagatgagcag
agccgctccctgacgagactgcggtattcttaccgggtcatctgcagtgacaactactat
ggggacaactgctcgcgcctgtgcaagaagcgaaatgaccacttcggccactacgtgtgc
cagccagatggcagcctgtcctgcttgcctggctggactgggaagtactgtgaccagcct
atttgtctttctggctgtaatgagcagaacggctactgcatcaagccagcagagtgcctc
tgccgcccaggctggcagggccgcctatgcaatgaatgtatcccccacaatggctgtcgc
catggcacctgcagcaccccctggcaatgtacctgtgatgagggctggggaggcctgttc
tgtgatcaagacctcaactactgcacccaccactccccatgcaagaatggggcgacatgc
tccaacagcgggcagcggagctatacctgcacctgtcgcccaggctatactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaaaaggacggctacctctgccagtgtcccccgggatactatggcttgcactgtgaa
cgcagcaccttgagctgcaccgactccccctgcttcaatggggggtcctgccaggagcgc
aaccaggggtccagctatgcctgcgaatgcccccctaacttcactggctccaactgcgag
aagaaagtggacaggtgcaccatcaacccgtgtgccaatggaggccagtgcctgaaccga
ggccccaacagcttgtgccgctgccgtccaggcttcacgggcgcccgctgtgaactcccc
atcagcagctgtgctcgcagcccttgcgctcatggaggcacttgccatgacctggagaat
gggctcttgtgcacctgccctcccggcttctcaggacagcgctgcgaggtgcgaacaccc
agcgatgcctgcgcctcagggccctgcttcaacggagccacctgctacactggcctctcc
ctggacagcttcatctgcaattgcccctatggcttcctgggcagccgctgcgagatccct
gtggacttgcctcccagcttcccctgggtagctgtctctctgggtgtggggctggtggtg
gtgctggtgctgctgggcatggtggctgtggctgtgcggcagctgcggcttcggcggcca
gacgatgacagcagggaggccatgaacaacttgtcagacttccagaaggacaacctgatc
cccgctgcccagctcaagaacacaaaccagaagaaggagctggaagtggactgtggcctc
gacaagtccaactgtggcaagcagcagaaccatacactggactacaatctggccccaggc
ctcctgggccgggggaccattccggggaagtacccccacagtgacaagagcttaggggag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaagagaggaacgaatgtgtc
attgctacggaggtataa

DBGET integrated database retrieval system