KEGG   Loxodonta africana (African savanna elephant): 100654942
Entry
100654942         CDS       T04351                                 

Gene name
SGCD
Definition
(RefSeq) delta-sarcoglycan
  KO
K12563  delta-sarcoglycan
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05412  Arrhythmogenic right ventricular cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100654942 (SGCD)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100654942 (SGCD)
   05414 Dilated cardiomyopathy
    100654942 (SGCD)
   05416 Viral myocarditis
    100654942 (SGCD)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 100654942
NCBI-ProteinID: XP_003404672
LinkDB
Position
Unknown
AA seq 289 aa
MPQEQYTHHRSTMSGSEGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMN
FTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIRSRPGNALYFKSARNVTVNILNDQTKV
LTQLITGPKAVEAYGKKFEVKTVSGKLLFSADDNEVVVGAERLRVLGAEGTVFPKSIETP
NVRAEPFKELRLESPTRSLVMEAPKGVEINAEAGNMEATCRTELRLESKDGEIKLDAAKI
RLPRLPHGSYTSTGTRQKVFEICVCANGRLFLSQAGAGSTCQINTSVCL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcctcaggaacagtacacacaccaccggagcaccatgtccggctccgaggggccacag
gtatacaaagtggggatttacggctggcggaagagatgcctgtacttctttgttctactc
ctgatgattttaatactggtgaacttggccatgaccatctggattctcaaagtcatgaac
ttcacaattgatggaatgggaaacttgagaatcacagaaaaaggtctaaagctcgaagga
gactcagaattcttacaacctctctacgccaaagaaatccgttcccggccaggtaatgcc
ctgtacttcaaatctgccagaaatgttacagtgaacattctcaatgaccagactaaagtg
ctaactcagctgataacaggtccaaaagccgtagaagcttatgggaaaaagtttgaagta
aaaaccgtctctggcaaattgctcttctcagcagatgacaatgaagtggtagtaggagct
gagcgattaagagttttaggtgcggagggcacagtgttccctaaatctatagaaacacct
aatgtcagggcggagcccttcaaggaactaaggctggagtccccgacccgttctctggtg
atggaggccccaaaaggagtagaaattaatgcagaagccggcaatatggaagccacttgc
agaacagagctgagactagagtccaaagatggagagattaagttagatgctgcgaaaatc
agactacctagactgcctcatggatcgtacacatcgacaggaacgaggcagaaggtcttc
gagatctgcgtctgcgccaacggaagattattcttatcccaggcaggagctggttccact
tgtcagataaacacaagtgtctgcctttga

DBGET integrated database retrieval system