KEGG   Loxodonta africana (African savanna elephant): 100654943
Entry
100654943         CDS       T04351                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04141  Protein processing in endoplasmic reticulum
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04310  Wnt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04530  Tight junction
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04926  Relaxin signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100654943 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100654943 (MAPK9)
   04012 ErbB signaling pathway
    100654943 (MAPK9)
   04014 Ras signaling pathway
    100654943 (MAPK9)
   04310 Wnt signaling pathway
    100654943 (MAPK9)
   04668 TNF signaling pathway
    100654943 (MAPK9)
   04068 FoxO signaling pathway
    100654943 (MAPK9)
   04071 Sphingolipid signaling pathway
    100654943 (MAPK9)
   04024 cAMP signaling pathway
    100654943 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100654943 (MAPK9)
   04137 Mitophagy - animal
    100654943 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100654943 (MAPK9)
   04215 Apoptosis - multiple species
    100654943 (MAPK9)
   04217 Necroptosis
    100654943 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100654943 (MAPK9)
   04530 Tight junction
    100654943 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100654943 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100654943 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100654943 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100654943 (MAPK9)
   04660 T cell receptor signaling pathway
    100654943 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100654943 (MAPK9)
   04659 Th17 cell differentiation
    100654943 (MAPK9)
   04657 IL-17 signaling pathway
    100654943 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100654943 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100654943 (MAPK9)
   04920 Adipocytokine signaling pathway
    100654943 (MAPK9)
   04912 GnRH signaling pathway
    100654943 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100654943 (MAPK9)
   04917 Prolactin signaling pathway
    100654943 (MAPK9)
   04926 Relaxin signaling pathway
    100654943 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100654943 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100654943 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100654943 (MAPK9)
   04722 Neurotrophin signaling pathway
    100654943 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100654943 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100654943 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654943 (MAPK9)
   05231 Choline metabolism in cancer
    100654943 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100654943 (MAPK9)
   05212 Pancreatic cancer
    100654943 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100654943 (MAPK9)
   05012 Parkinson disease
    100654943 (MAPK9)
   05016 Huntington disease
    100654943 (MAPK9)
   05017 Spinocerebellar ataxia
    100654943 (MAPK9)
   05020 Prion disease
    100654943 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100654943 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100654943 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100654943 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100654943 (MAPK9)
   04931 Insulin resistance
    100654943 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100654943 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654943 (MAPK9)
   05135 Yersinia infection
    100654943 (MAPK9)
   05133 Pertussis
    100654943 (MAPK9)
   05152 Tuberculosis
    100654943 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100654943 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100654943 (MAPK9)
   05161 Hepatitis B
    100654943 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100654943 (MAPK9)
   05162 Measles
    100654943 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100654943 (MAPK9)
   05169 Epstein-Barr virus infection
    100654943 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100654943 (MAPK9)
   05142 Chagas disease
    100654943 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100654943 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100654943 (MAPK9)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100654943 (MAPK9)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100654943 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100654943
NCBI-ProteinID: XP_003404756
LinkDB
Position
Unknown
AA seq 424 aa
MSDGKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSVDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacggtaaatgtgatagtcagttttacagtgtgcaagtggcagactcaacattc
actgtcctaaaacgctaccagcagttaaaaccaattggctctggagctcaaggaattgtt
tgtgctgctttcgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
ttccagaatcaaacccatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctacattcagctggtataattcatagagatttgaagcccagcaacattgtagtaaaa
tcagactgcacccttaagatccttgactttggtctggcccgaacagcatgcactaacttc
atgatgaccccctacgtggtaacacgatattaccgagcacccgaagtcattctgggcatg
ggatacaaagaaaatgttgatatctggtcagtgggttgcatcatgggagaactggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagttattgagcag
ctaggaacaccatcagtggatttcatgaagaagcttcagccaactgtgagaaattacgtg
gaaaacagaccaaagtatcctggaatcaaatttgaagaactttttccagattggatattt
ccatcagaatctgaacgagataaaataaaaacaagtcaagccagagatttgttgtcgaag
atgttagtaattgatcctgacaagcgaatctctgtagatgaagctttacgtcacccatat
atcactgtgtggtatgaccctgctgaggcagaagcaccaccacctcaaatttatgatgct
caattggaagaaagagaacatgcaatagaagaatggaaagagctgatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaatgccactccttctcagtcgtcatctatcaacgacatctcatccatgtcc
actgagcagacactggcctcggatactgacagcagcctcgatgcctcgacgggacccctg
gaaggttgtcgatga

KEGG   Loxodonta africana (African savanna elephant): 100656926
Entry
100656926         CDS       T04351                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656926 (MAPK13)
   04015 Rap1 signaling pathway
    100656926 (MAPK13)
   04370 VEGF signaling pathway
    100656926 (MAPK13)
   04668 TNF signaling pathway
    100656926 (MAPK13)
   04068 FoxO signaling pathway
    100656926 (MAPK13)
   04071 Sphingolipid signaling pathway
    100656926 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100656926 (MAPK13)
   04218 Cellular senescence
    100656926 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100656926 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100656926 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100656926 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100656926 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100656926 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100656926 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100656926 (MAPK13)
   04660 T cell receptor signaling pathway
    100656926 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100656926 (MAPK13)
   04659 Th17 cell differentiation
    100656926 (MAPK13)
   04657 IL-17 signaling pathway
    100656926 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100656926 (MAPK13)
   04670 Leukocyte transendothelial migration
    100656926 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100656926 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100656926 (MAPK13)
   04917 Prolactin signaling pathway
    100656926 (MAPK13)
   04926 Relaxin signaling pathway
    100656926 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100656926 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656926 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100656926 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100656926 (MAPK13)
   04722 Neurotrophin signaling pathway
    100656926 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100656926 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656926 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100656926 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100656926 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100656926 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100656926 (MAPK13)
   05020 Prion disease
    100656926 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100656926 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100656926 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100656926 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656926 (MAPK13)
   05135 Yersinia infection
    100656926 (MAPK13)
   05133 Pertussis
    100656926 (MAPK13)
   05152 Tuberculosis
    100656926 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100656926 (MAPK13)
   05161 Hepatitis B
    100656926 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100656926 (MAPK13)
   05163 Human cytomegalovirus infection
    100656926 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656926 (MAPK13)
   05169 Epstein-Barr virus infection
    100656926 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100656926 (MAPK13)
   05140 Leishmaniasis
    100656926 (MAPK13)
   05142 Chagas disease
    100656926 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100656926 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100656926 (MAPK13)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100656926 (MAPK13)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100656926 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kdo Kinase-like DUF4023
Other DBs
NCBI-GeneID: 100656926
NCBI-ProteinID: XP_003404273
UniProt: G3SVM7
LinkDB
Position
Unknown
AA seq 366 aa
MSLTRRKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEMFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFTEEKIQYLMYQTLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQAIDLLEKMLELDVDKRLTAS
QALTHPFFEPFRDPEEETEAEQPFDESLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcacccggagaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtaggcagcggggcctatggagccgtgtgc
tctgccatcgacaagcggtcaggggagaaggtagccatcaagaagctgagtcggcccttc
cagtctgagatgtttgccaagcgggcctatcgggagctgttgctgctgaaacacatgcaa
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcaccgaggaaaagattcagtacctgatgtatcagactctcaagggtcttaagtac
atccactcagctggagtcatccacagggacctgaagccaggcaacctagctgtgaatgag
gactgcgaattgaagatcctggattttgggctggcacggcacgcggacactgagatgact
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtagacatctggtctgttggttgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagactacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcgcagagtttgtgcagaagcttaacgacaaggcggccaaatcctacatccag
tccctgccacagagtcctaagaaggatttctctcagctcttcccacgtgccagccctcag
gccatagacctgcttgagaagatgctggagctggatgttgacaagcgcctgacagcctcg
caggccctcacccaccccttctttgaacccttccgggaccctgaggaggagacggaggcc
gagcagccatttgatgaatccttagagcatgagaagctcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccctatcgcccgcaaggactcacggcggcgg
agtggcatgaagctgcagtga

KEGG   Loxodonta africana (African savanna elephant): 100661039
Entry
100661039         CDS       T04351                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661039 (MAPK12)
   04015 Rap1 signaling pathway
    100661039 (MAPK12)
   04370 VEGF signaling pathway
    100661039 (MAPK12)
   04668 TNF signaling pathway
    100661039 (MAPK12)
   04068 FoxO signaling pathway
    100661039 (MAPK12)
   04071 Sphingolipid signaling pathway
    100661039 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100661039 (MAPK12)
   04218 Cellular senescence
    100661039 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100661039 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100661039 (MAPK12)
   04613 Neutrophil extracellular trap formation
    100661039 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100661039 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100661039 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100661039 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100661039 (MAPK12)
   04660 T cell receptor signaling pathway
    100661039 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100661039 (MAPK12)
   04659 Th17 cell differentiation
    100661039 (MAPK12)
   04657 IL-17 signaling pathway
    100661039 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100661039 (MAPK12)
   04670 Leukocyte transendothelial migration
    100661039 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100661039 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100661039 (MAPK12)
   04917 Prolactin signaling pathway
    100661039 (MAPK12)
   04926 Relaxin signaling pathway
    100661039 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100661039 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100661039 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100661039 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100661039 (MAPK12)
   04722 Neurotrophin signaling pathway
    100661039 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100661039 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100661039 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100661039 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100661039 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100661039 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100661039 (MAPK12)
   05020 Prion disease
    100661039 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100661039 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100661039 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100661039 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100661039 (MAPK12)
   05135 Yersinia infection
    100661039 (MAPK12)
   05133 Pertussis
    100661039 (MAPK12)
   05152 Tuberculosis
    100661039 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661039 (MAPK12)
   05161 Hepatitis B
    100661039 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100661039 (MAPK12)
   05163 Human cytomegalovirus infection
    100661039 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661039 (MAPK12)
   05169 Epstein-Barr virus infection
    100661039 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100661039 (MAPK12)
   05140 Leishmaniasis
    100661039 (MAPK12)
   05142 Chagas disease
    100661039 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100661039 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661039 (MAPK12)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100661039 (MAPK12)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100661039 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 100661039
NCBI-ProteinID: XP_023398398
LinkDB
Position
Unknown
AA seq 259 aa
MPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELK
ILDFGLARQADSEMTGYVVTRWYRAPEVILNWKHYTQTVDIWSVGCIMAEMITGKTLFKG
NDHLDQLKEIMKVTGTPSAEFVQGLQSADAKNYMKGLPELEKKDFASILTNASPLAVNLL
EKMLVLDAEQRVTAAEALAHPYFEALHEAEDEPTPQKYDDSFDDVDRTLDEWKRVTYKEV
LSFKPPRQLGSRASKETAL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgccgttcatgggcaccgacctgggcaagctcatgaagcacgagaagctgagtgaggac
cgcatccagttccttgtgtaccagatgctgaaggggctcaagtacatccatgctgctggt
atcatccacagggacctcaagcccggcaacctggcggtgaacgaggactgtgagctaaag
atcctggactttggcctggccagacaggcagacagtgagatgaccggatacgtggtgacc
cggtggtaccgggcaccagaagtcatcctgaactggaagcactatacacagacagtcgac
atttggtcggtgggctgcatcatggccgagatgatcaccgggaagacgctgtttaagggc
aatgaccacctggatcagctgaaggagatcatgaaggtgacgggaacaccctcggctgag
tttgtgcaggggctgcagagtgccgacgctaagaactacatgaagggacttcctgagctg
gagaagaaggactttgcgtccatcctgaccaacgccagtcccctcgccgtgaacctcctg
gagaagatgctggtgctggatgcggagcagcgggtgacagcggctgaggcgctggcccac
ccctacttcgaggccctgcatgaggcagaggacgagcctacgccacagaagtacgatgac
tcctttgacgatgtagaccggacgctggatgagtggaagcgtgtcacctataaagaggtg
ctcagcttcaagcctccccggcagctggggtcgagggcttccaaggagacagctctgtga

KEGG   Loxodonta africana (African savanna elephant): 100673331
Entry
100673331         CDS       T04351                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673331 (MAPK14)
   04015 Rap1 signaling pathway
    100673331 (MAPK14)
   04370 VEGF signaling pathway
    100673331 (MAPK14)
   04668 TNF signaling pathway
    100673331 (MAPK14)
   04068 FoxO signaling pathway
    100673331 (MAPK14)
   04071 Sphingolipid signaling pathway
    100673331 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100673331 (MAPK14)
   04218 Cellular senescence
    100673331 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100673331 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673331 (MAPK14)
   04613 Neutrophil extracellular trap formation
    100673331 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100673331 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100673331 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100673331 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100673331 (MAPK14)
   04660 T cell receptor signaling pathway
    100673331 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100673331 (MAPK14)
   04659 Th17 cell differentiation
    100673331 (MAPK14)
   04657 IL-17 signaling pathway
    100673331 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100673331 (MAPK14)
   04670 Leukocyte transendothelial migration
    100673331 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100673331 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100673331 (MAPK14)
   04917 Prolactin signaling pathway
    100673331 (MAPK14)
   04926 Relaxin signaling pathway
    100673331 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100673331 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100673331 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100673331 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100673331 (MAPK14)
   04722 Neurotrophin signaling pathway
    100673331 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100673331 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100673331 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100673331 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100673331 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100673331 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100673331 (MAPK14)
   05020 Prion disease
    100673331 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100673331 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673331 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673331 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673331 (MAPK14)
   05135 Yersinia infection
    100673331 (MAPK14)
   05133 Pertussis
    100673331 (MAPK14)
   05152 Tuberculosis
    100673331 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100673331 (MAPK14)
   05161 Hepatitis B
    100673331 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100673331 (MAPK14)
   05163 Human cytomegalovirus infection
    100673331 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673331 (MAPK14)
   05169 Epstein-Barr virus infection
    100673331 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100673331 (MAPK14)
   05140 Leishmaniasis
    100673331 (MAPK14)
   05142 Chagas disease
    100673331 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100673331 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673331 (MAPK14)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100673331 (MAPK14)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100673331 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 100673331
NCBI-ProteinID: XP_003403994
UniProt: G3SVM3
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cctgagcgctatcagaacctgtccccggtgggctccggtgcctatggctcggtatgtgct
gcttttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtatttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatcttatgggggcagatctgaacaacattgtaaaatgtcag
aagcttacggatgaccacgtacaattccttatctaccaaattctccgaggcctaaagtat
atacattcagccgacataattcacagggacctaaagcctagtaatctagctgtgaacgaa
gactgtgagctgaagatcctggattttggcctggctcggcacacagacgacgaaatgaca
ggctatgtggccaccaggtggtacagggctcccgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtgttggactcagataagagaatcacagcagcc
caagccctcgcgcatgcttactttgctcagtaccatgaccccgatgatgagccggtggca
gatccttacgaccagtccttcgaaagcagggacctcctgatagatgagtggaaaagcctg
acctacgatgaagtcatcagttttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Loxodonta africana (African savanna elephant): 100673395
Entry
100673395         CDS       T04351                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04141  Protein processing in endoplasmic reticulum
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04310  Wnt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04530  Tight junction
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04926  Relaxin signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100673395 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673395 (MAPK10)
   04012 ErbB signaling pathway
    100673395 (MAPK10)
   04014 Ras signaling pathway
    100673395 (MAPK10)
   04310 Wnt signaling pathway
    100673395 (MAPK10)
   04668 TNF signaling pathway
    100673395 (MAPK10)
   04068 FoxO signaling pathway
    100673395 (MAPK10)
   04071 Sphingolipid signaling pathway
    100673395 (MAPK10)
   04024 cAMP signaling pathway
    100673395 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100673395 (MAPK10)
   04137 Mitophagy - animal
    100673395 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100673395 (MAPK10)
   04215 Apoptosis - multiple species
    100673395 (MAPK10)
   04217 Necroptosis
    100673395 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100673395 (MAPK10)
   04530 Tight junction
    100673395 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100673395 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100673395 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100673395 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100673395 (MAPK10)
   04660 T cell receptor signaling pathway
    100673395 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100673395 (MAPK10)
   04659 Th17 cell differentiation
    100673395 (MAPK10)
   04657 IL-17 signaling pathway
    100673395 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100673395 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100673395 (MAPK10)
   04920 Adipocytokine signaling pathway
    100673395 (MAPK10)
   04912 GnRH signaling pathway
    100673395 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100673395 (MAPK10)
   04917 Prolactin signaling pathway
    100673395 (MAPK10)
   04926 Relaxin signaling pathway
    100673395 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100673395 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100673395 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100673395 (MAPK10)
   04722 Neurotrophin signaling pathway
    100673395 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100673395 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100673395 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673395 (MAPK10)
   05231 Choline metabolism in cancer
    100673395 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100673395 (MAPK10)
   05212 Pancreatic cancer
    100673395 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100673395 (MAPK10)
   05012 Parkinson disease
    100673395 (MAPK10)
   05016 Huntington disease
    100673395 (MAPK10)
   05017 Spinocerebellar ataxia
    100673395 (MAPK10)
   05020 Prion disease
    100673395 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100673395 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673395 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100673395 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100673395 (MAPK10)
   04931 Insulin resistance
    100673395 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673395 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673395 (MAPK10)
   05135 Yersinia infection
    100673395 (MAPK10)
   05133 Pertussis
    100673395 (MAPK10)
   05152 Tuberculosis
    100673395 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100673395 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100673395 (MAPK10)
   05161 Hepatitis B
    100673395 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100673395 (MAPK10)
   05162 Measles
    100673395 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673395 (MAPK10)
   05169 Epstein-Barr virus infection
    100673395 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100673395 (MAPK10)
   05142 Chagas disease
    100673395 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100673395 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673395 (MAPK10)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100673395 (MAPK10)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100673395 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100673395
NCBI-ProteinID: XP_003414147
LinkDB
Position
Unknown
AA seq 464 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttgtactactgcagtgaacctaccttggatgtgaaaattgccttt
tgtcagggatttgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtacgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccttttcag
aaccaaacacatgccaagagagcttaccgggagctggtcctcatgaaatgtgtaaaccat
aaaaatattattagtttattaaatgttttcacaccccagaagacactggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgccaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctataccaaatgctgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacgttgaaaatcctcgactttggactagccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacgcgctattacagagcccccgaggtcattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggattatattgaccagtggaataaggtaattgagcaactagga
acgccatgcccagaattcatgaagaaattgcaacccacagtgagaaactatgttgaaaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgatccagcaaaaaggatatcagtggatgacgccttacagcacccgtacatcaat
gtctggtacgaccctgctgaagtggaggcgcctccgcctcagatatatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaactaatctacaaggaagtaatgaat
tcagaagaaaagacgaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcatccgtcaacgacatctcctccatgtcc
accgaccagaccctggcgtctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Loxodonta africana (African savanna elephant): 100674229
Entry
100674229         CDS       T04351                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04141  Protein processing in endoplasmic reticulum
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04217  Necroptosis
lav04310  Wnt signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04530  Tight junction
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04926  Relaxin signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05231  Choline metabolism in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100674229 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100674229 (MAPK8)
   04012 ErbB signaling pathway
    100674229 (MAPK8)
   04014 Ras signaling pathway
    100674229 (MAPK8)
   04310 Wnt signaling pathway
    100674229 (MAPK8)
   04668 TNF signaling pathway
    100674229 (MAPK8)
   04068 FoxO signaling pathway
    100674229 (MAPK8)
   04071 Sphingolipid signaling pathway
    100674229 (MAPK8)
   04024 cAMP signaling pathway
    100674229 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100674229 (MAPK8)
   04137 Mitophagy - animal
    100674229 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100674229 (MAPK8)
   04215 Apoptosis - multiple species
    100674229 (MAPK8)
   04217 Necroptosis
    100674229 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674229 (MAPK8)
   04530 Tight junction
    100674229 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100674229 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100674229 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100674229 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100674229 (MAPK8)
   04660 T cell receptor signaling pathway
    100674229 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100674229 (MAPK8)
   04659 Th17 cell differentiation
    100674229 (MAPK8)
   04657 IL-17 signaling pathway
    100674229 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100674229 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100674229 (MAPK8)
   04920 Adipocytokine signaling pathway
    100674229 (MAPK8)
   04912 GnRH signaling pathway
    100674229 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100674229 (MAPK8)
   04917 Prolactin signaling pathway
    100674229 (MAPK8)
   04926 Relaxin signaling pathway
    100674229 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100674229 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100674229 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100674229 (MAPK8)
   04722 Neurotrophin signaling pathway
    100674229 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100674229 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100674229 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674229 (MAPK8)
   05231 Choline metabolism in cancer
    100674229 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100674229 (MAPK8)
   05212 Pancreatic cancer
    100674229 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674229 (MAPK8)
   05012 Parkinson disease
    100674229 (MAPK8)
   05016 Huntington disease
    100674229 (MAPK8)
   05017 Spinocerebellar ataxia
    100674229 (MAPK8)
   05020 Prion disease
    100674229 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100674229 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100674229 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100674229 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100674229 (MAPK8)
   04931 Insulin resistance
    100674229 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100674229 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100674229 (MAPK8)
   05135 Yersinia infection
    100674229 (MAPK8)
   05133 Pertussis
    100674229 (MAPK8)
   05152 Tuberculosis
    100674229 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100674229 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100674229 (MAPK8)
   05161 Hepatitis B
    100674229 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100674229 (MAPK8)
   05162 Measles
    100674229 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100674229 (MAPK8)
   05169 Epstein-Barr virus infection
    100674229 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100674229 (MAPK8)
   05142 Chagas disease
    100674229 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100674229 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100674229 (MAPK8)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100674229 (MAPK8)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100674229 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 100674229
NCBI-ProteinID: XP_003408979
UniProt: G3UEK5
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSANDESSMSTDPTLASDTDSSLEASS
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacagcaatttttatagcgtagagattggagattctacattc
acagtcctgaaacgataccagaatttaaaacctataggctcaggagctcaaggaattgta
tgtgcagcttatgatgccattcttgaaagaaatgttgcgatcaagaagctgagtcggcca
tttcagaatcaaactcatgctaagcgggcttacagagaactagttcttatgaaatgtgtt
aatcacaaaaatataattggccttctgaatgtgtttacaccgcagaaatccctggaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcaa
atggaactagaccatgaaagaatgtcctaccttctgtatcagatgctgtgtggaatcaag
cacctgcactcggctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccagaactgcaggaacgagcttc
atgatgacaccttatgtggtgactcgctactacagagcccccgaggtcatcctggggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaagaggatctctgtagacgaagctctccagcacccgtac
atcaatgtctggtatgacccttctgaagcagaagctccaccacccaagatccccgacaag
cagttagacgaaagggagcacaccatcgaggagtggaaagaactgatatacaaggaagtt
atggacttggaggagagaaccaagaatggagtaatacggggtcagccctctcctttaggt
gcagcagtgatcaacggctctcagcacccatcgtcgtcgtcatcggccaatgacgagtct
tcaatgtcaacagacccaactttggcctctgatacagacagcagtctggaagcatcatca
ggacctctgggctgctgtagatga

DBGET integrated database retrieval system