KEGG   Loxodonta africana (African savanna elephant): 100654973
Entry
100654973         CDS       T04351                                 

Gene name
ADRB1
Definition
(RefSeq) LOW QUALITY PROTEIN: beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04261  Adrenergic signaling in cardiomyocytes
lav04540  Gap junction
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04970  Salivary secretion
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100654973 (ADRB1)
   04024 cAMP signaling pathway
    100654973 (ADRB1)
   04022 cGMP-PKG signaling pathway
    100654973 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100654973 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100654973 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100654973 (ADRB1)
   04924 Renin secretion
    100654973 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100654973 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    100654973 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100654973 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100654973 (ADRB1)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100654973 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 100654973
NCBI-ProteinID: XP_010587602
LinkDB
Position
Unknown
AA seq 563 aa
MGAGALALGASEPCNLSSAAPLPEGAATAARLLVPASPSPSLVPPVSEGPAPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYESLLTRARARVLVC
TVWAISALVSFLPILMHWWRDKGEEALRCYEDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARQPSPAPSPTPPRAPAPVANGRAGKRRPSR
LVALREQKALKTHPRGFHSAPRRPAAAPRAAWAVAGPPPSPGAXDDDDDDDVGAAPPRAL
LEPWAGQTAGAVADSDSSLDEPTPPGLRLGIQSVGPRELRDARAPPRCRPGTRSLRPGEE
ERPGTLEWLPRGKGRACVYSRPKAGECDAHKPRPNQPRQKEKPRTVARKGKFGEGWESGL
RVLLEFFDVCGWPSSVCAACYSGGTRWLDRGLHLAVLLFIFSMSVPLSDQLLRKVALTVS
PAAMSSITGLYPLDASCENQKCL
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgccctgggcgcctccgagccctgcaacctgtcgtcggctgct
ccgcttcccgaaggcgcggccacagccgcgagactgctggtgccggcatcgccgtccccc
tctttggtgcccccagtgagcgaaggccccgcaccgctgtcgcagcagtggacggccggc
atgggcctactgatggcgctcatcgtgctgctcatcgtggcgggcaacgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgaactttggacctcggtggacgtgcta
tgtgtgacggccagcatcgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acgtcccccttccgctatgagagtctgctgacccgcgcgcgggcgcgggtcctcgtctgc
accgtgtgggccatctcggccctggtatccttcctgcccattctcatgcactggtggcgg
gacaagggcgaagaggcgctccgctgctatgaggaccccaagtgctgcgacttcgtcacc
aaccgggcctacgctatcgcctcgtccgtcgtctccttctacgtgcccctgtgcatcatg
gctttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgcttcctcggcggccccgcgcggcagccctcgcccgcgccctctccgacc
cctccgcgcgcccctgccccggtggccaacggccgcgccggcaagcggcggccctcgcgc
ctcgtggccctccgcgagcagaaggcgctcaagacccacccccggggcttccattcggcc
ccccggcgaccggccgccgcgccccgggctgcctgggctgtggccgggccgcccccgtcg
cccggggccnncgacgacgacgacgacgacgacgttggggccgcaccgccgcgagccctg
ctggagccctgggccggccaaacggcgggggcggtggcggacagcgactcgagcctggac
gagccgaccccgccggggctccggctcggaatccaaagtgtagggccgcgcgagctgcgg
gacgccagggccccgccacgctgccggcctgggacgcggagtctgcgtcccggggaggag
gagcgcccgggcaccctggaatggcttcccaggggaaaggggagagcttgtgtttactca
agaccgaaagcaggtgaatgcgacgcccacaaacctcgtccgaatcagccaagacaaaaa
gaaaagccacgcaccgttgcacgaaaaggaaagtttggggagggatgggagagtggcttg
cgggttttgctggagttctttgatgtttgtggttggccttcttctgtgtgtgcggcttgc
tattctgggggtacccgctggctcgaccggggcttgcacttggcagtcctgcttttcatc
ttcagcatgtccgtcccactctctgatcagctcctccgtaaggtggctttgactgtctcc
ccagctgccatgtcctccatcactggcctctacccactagatgctagttgtgagaaccag
aaatgtctgtag

DBGET integrated database retrieval system