KEGG   Loxodonta africana (African savanna elephant): 100654985
Entry
100654985         CDS       T04351                                 

Gene name
PPARGC1A
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform X2
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04371  Apelin signaling pathway
lav04714  Thermogenesis
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04922  Glucagon signaling pathway
lav04931  Insulin resistance
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100654985 (PPARGC1A)
   04152 AMPK signaling pathway
    100654985 (PPARGC1A)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100654985 (PPARGC1A)
   04922 Glucagon signaling pathway
    100654985 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    100654985 (PPARGC1A)
  09149 Aging
   04211 Longevity regulating pathway
    100654985 (PPARGC1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    100654985 (PPARGC1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100654985 (PPARGC1A)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100654985 (PPARGC1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100654985 (PPARGC1A)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100654985 (PPARGC1A)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 100654985
NCBI-ProteinID: XP_003411338
UniProt: G3TAG2
LinkDB
Position
Unknown
AA seq 796 aa
MAWDMCNQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQS
EIISNQYNNEPSNIFEKIDEESEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTDND
ASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYSECSGLSTQNHANHNHRIRTNPAV
VKTETSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSHRDKCTSKKKP
HTQSQVSHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPH
KANQDNPFRTSPKLKSSCKTVVPLPSKKPRHSESSGTQGNNSTKKGPKQSELYAQLSKTS
VLTSGHEERKTKRPSLRLFGDHDYCQSINSKSEILINISQELQDSRKLEYKDASSDWQGQ
ICSSTDSDQCYLRETLEASKQVSPGSTRKQLQDQEIRAELNKHFGHPSQAVFDDEANKTS
ELRDSDFSNEQFSKLPMFINSGLAMDGMFEDSEDESDKLSYPWDGTQSYSLFDVSPSCSS
FNSPCRDSVSPPKSLFSQRPQRMCSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCHY
CESSHCRHRTHRNPPLCGRSRSRSPCSRRPRYDSYEEYQHERLKREEYRKEYEKRESERA
KQRERQRQKAIEERRVIYVGKIGSDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITY
RYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASAKSKYDS
LDFDSLLKEAQRSLRR
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggcgtgggacatgtgcaaccaggactctgtatggagtgacatcgagtgtgctgctctg
gttggtgaagaccagcctctttgcccagatcttcctgaacttgacctttctgaactagac
gtgaacgacttggatacagacagctttctgggtggactcaagtggtgcagtgaccaatca
gaaataatttccaaccagtacaacaatgagccttcaaatatatttgagaagatagatgaa
gagagtgaggcaaacttgctagcagtcctcacagagacactggacagtctccctgtggat
gaagacggattgccctcgtttgatgcgctgacagatggagatgtgaccactgacaatgac
gctagtccttcctctatgcccgacggcacccctccgcctcaggaggcagaagagccatct
ctacttaagaagctcttactggcaccagccaatactcagctaagttatagtgaatgcagt
ggtctcagtacccagaaccatgcaaaccataatcacaggatcagaacaaaccctgcagtt
gttaagaccgagacttcatggagcaataaagcaaagagcatttgtcaacagcaaaagcca
caaagacgtccctgctccgagcttctcaagtatctgaccacaaacgatgaccctcctcac
accaaacccacagagaacagaaacagccacagagacaaatgcacctcgaaaaagaagccc
cacacacagtcgcaggtgtcccatttacaagccaaaccaacaactttatctcttcctctg
accccagagtcaccaaatgaccccaagggttccccatttgagaacaagactattgaacga
accttaagtgtggaactctctggaactgcaggcctaactccacccacaactcctcctcat
aaagccaaccaagataacccttttaggacttctccaaaattgaagtcctcttgcaagact
gtggtaccactaccatcaaagaagccccggcatagcgagtcttctggtacccaaggaaac
aactccaccaagaaaggtcccaagcaatctgagttgtacgcacaactcagcaagacctcg
gtactcaccagtggacacgaggaaaggaagaccaagcggcccagtctgcggttgtttggt
gaccatgactattgtcagtcaattaattccaaatcggaaatactcattaatatatcacag
gagctccaagactctagaaaactagaatataaagatgcctccagtgattggcaggggcag
atttgttcttccacagactcagaccagtgctacctgagagagactttggaggccagcaag
caagtctctcctggcagcaccagaaaacagctccaagaccaggaaatccgagccgagctg
aacaagcactttggtcatcccagtcaagctgtttttgacgacgaagcaaacaagaccagt
gaactgagggacagtgattttagtaatgaacaattctccaaactacctatgtttataaat
tcaggactagccatggatggcatgtttgaggacagcgaagatgaaagtgataaactgagc
tacccttgggatggcacgcaatcctattcattgttcgatgtgtcgccttcttgctcttca
tttaactctccgtgtagagattccgtgtcgccacccaaatccttattttctcaaagaccc
caaaggatgtgctctcgttcaaggtccttttctcgacacaggtcctgttcccggtcaccg
tattccaggtcaagatctaggtccccaggcagtagatcctcttcaagatcttgccactac
tgtgagtcaagccactgcagacaccgcacgcaccgaaatcctcccttgtgcgggagatca
cgctccagatcaccctgcagccgtaggcccaggtatgacagctacgaggagtatcagcac
gaaaggctgaagagggaagaataccgcaaagagtatgagaagcgggagtctgaaagggcc
aaacaaagggagagacagaggcagaaggcaattgaagaacgccgtgtgatatatgttggt
aaaatcggatctgacacaacacggacagaactgagggaccgttttgaagtttttggtgaa
attgaggagtgcacagtaaatctgcgggatgatggagacagctatggtttcattacctac
cgttatacctgcgatgcttttgctgctcttgaaaatggatacactttgcgcaggtcgaat
gaaactgacttcgagctgtacttttgtggacgcaagcaatttttcaagtctaactatgca
gacctagattcaaactctgatgactttgaccctgcttccgccaagagcaagtatgactct
ctggatttcgatagtttactgaaagaggctcagagaagcttacgcaggtaa

DBGET integrated database retrieval system