KEGG   Loxodonta africana (African savanna elephant): 100654997
Entry
100654997         CDS       T04351                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100654997 (FZD2)
   04390 Hippo signaling pathway
    100654997 (FZD2)
   04150 mTOR signaling pathway
    100654997 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100654997 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100654997 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654997 (FZD2)
   05205 Proteoglycans in cancer
    100654997 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100654997 (FZD2)
   05226 Gastric cancer
    100654997 (FZD2)
   05217 Basal cell carcinoma
    100654997 (FZD2)
   05224 Breast cancer
    100654997 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100654997 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100654997 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100654997 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100654997 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100654997 (FZD2)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100654997 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100654997
NCBI-ProteinID: XP_003414548
LinkDB
Position
Unknown
AA seq 509 aa
MPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICER
ARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGA
GGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFF
SQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIA
GFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAA
GMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFV
LAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIV
IACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSG
FWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcccaaccttctgggccacacgaaccaggaggacgcgggcctggaggtgcaccagttc
tacccgctggtgaaagtgcagtgctcgcccgaactgcgcttcttcctgtgctctatgtac
gcgccggtgtgcaccgtgctggagcaggccatcccgccgtgccgctccatttgcgagcgc
gcgcgccagggctgcgaggcgctcatgaacaagttcggttttcagtggcccgagcgcctg
cgctgcgagcacttcccgcgccacggcgcggagcagatctgcgtgggccaaaaccactca
gaggacggcgcccccgcgttgctcactactgcgccgccgccaggcctgcagccgggtgct
gggggcacaccaggcggcccgggcggcggcggtgcgccccctcgttacgccacgctggag
cacccgttccactgcccccgtgtcctcaaagtgccgtcctatctcagttataaattccta
ggcgaacgcgactgcgcggcgccctgcgagccggcgcggccggacggctccatgttcttc
tcgcaggaggagacccgctttgcccgcctctggattctcacctggtctgtgctttgctgc
gcctccactttcttcactgtcaccacgtacctggtggacatgcagcgcttccgctacccc
gagcggccaatcatcttcctgtcgggctgctacacaatggtgtccgtggcctacatcgcg
ggcttcgtgctgcaggagcgcgtggtgtgcaacgagcgcttctctgaggacggttaccgc
acggtggtgcagggcaccaaaaaggagggctgcaccattctcttcatgatgctctacttc
tttagcatggccagctctatctggtgggttatcctgtcactcacctggttcctggcggcc
ggcatgaagtggggccacgaagccattgaggccaattcgcagtacttccacttggccgcg
tgggccgtgccggctgtcaagaccatcaccatcctggccatgggccagattgacggagac
ctgctgagcggcgtgtgcttcgtgggcctaaacagcctggatccgctgcgaggcttcgtg
ctggcgccgcttttcgtgtacttgttcattggcacgtccttcctcctggccggcttcgtg
tcgctcttccgcatccgaaccatcatgaagcacgacggcaccaagacggagaagctagag
cggctcatggtgcgcatcggcgttttctcggtgctctacacggtgcctgccaccatcgtg
atcgcctgctatttctacgagcaggccttccgcgagcactgggagcgctcgtgggtaagc
cagcactgcaagagcctggccatcccttgcccggcgcactacacgccgcgcatgtcgccc
gacttcaccgtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggc
ttctggatctggtctggcaagacgctgcactcgtggaggaagttctacacccgcctcacc
aacagccggcacggcgagaccacggtgtaa

KEGG   Loxodonta africana (African savanna elephant): 100657335
Entry
100657335         CDS       T04351                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100657335 (FZD1)
   04390 Hippo signaling pathway
    100657335 (FZD1)
   04150 mTOR signaling pathway
    100657335 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100657335 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100657335 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657335 (FZD1)
   05205 Proteoglycans in cancer
    100657335 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100657335 (FZD1)
   05226 Gastric cancer
    100657335 (FZD1)
   05217 Basal cell carcinoma
    100657335 (FZD1)
   05224 Breast cancer
    100657335 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657335 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100657335 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657335 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657335 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100657335 (FZD1)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100657335 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100657335
NCBI-ProteinID: XP_003407202
LinkDB
Position
Unknown
AA seq 650 aa
MAEEEAPKKSQAAGGGSWELCVGALPARRAAEGSGDRGNGRRPPSDPGRLARRLLLLLWL
LEAPLLLGVQAQAAGQGPGQGPGPGQQPPPPPPQQQQSGQQYNGERGISIPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQYGGGGHRSGGGGFLGGAGASDRGKFSCPRALKVPSYLNYHFLGEKDCG
APCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIF
LSGCYTAVAVAYIAGFLLEDRVVCNDKFTEDGARTVAQGTKKEGCTILFMMLYFFSMASS
IWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVC
FVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRI
GVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMS
PDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccaggccgccggcggcgggagctgggaactt
tgtgtgggggcgctccctgcccggcgggcggcggaggggagcggggacaggggcaacggt
cgccgccccccatctgaccccgggcgcttggcgcgccggctgctgctgctgctttggctg
ctagaggctccactgctgctgggggtccaggctcaggcggcgggccaggggccggggcaa
gggcccgggccaggccagcagcccccgccgccgccgcctcagcagcagcagagcgggcaa
cagtacaacggcgagcgaggcatctccattccggaccacggctactgccagcctatctcc
atcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccac
acgaaccaggaggacgcaggcctcgaggtgcaccagttctatccgctggtgaaggtccag
tgctccgctgagcttaagttcttcttgtgctccatgtacgcgcccgtgtgcaccgtgctg
gagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggttgcgaggcg
ctcatgaacaagttcggcttccagtggcccgacacgctcaagtgcgagaagttcccggtg
cacggcgccggcgagctgtgcgtgggccagaacacgtccgacaaaggcactccgacgccc
tcgctgctgccggagttctggactagcaatccccagtacggcggcgggggccaccgcagc
ggcggaggcggcttcctggggggcgccggcgcgtcggaccgaggcaagttctcgtgccct
cgtgccctcaaggtaccctcgtacctcaattaccactttctgggggagaaggactgcggg
gcgccctgtgagccaaccaaggtgtacgggctcatgtactttgggccggaggagctgcgc
ttctcgcgcacctggatcggcatctggtcggtactatgctgcgcctccacactcttcacg
gtgcttacgtacctggtggacatgcggcgctttagctaccccgagcgacccatcatcttc
ctgtctggctgctacacggctgtggccgtggcctacattgccggcttcctgctggaggac
cgggtggtgtgtaacgacaagttcaccgaggatggagcgcgcacggtggcgcagggcacc
aagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctcc
atctggtgggtgatcctgtcactcacctggtttctggcggccggcatgaagtggggccat
gaggccatcgaggccaactcgcagtactttcacctggccgcctgggcggtgccggccatc
aagaccatcaccatcttggcgctgggccaagtggacggcgacgtgctgagcggggtatgc
ttcgtggggcttaacaacgtggacgcactgcgcggttttgtgctggcgcccctcttcgtg
tacttattcataggtacgtctttcctgctggctggcttcgtgtcgctcttccgcatccgc
accattatgaagcacgacggcaccaaaaccgagaagctggagaagctcatggtgcgcatc
ggggtcttcagcgtgctctacacggtgccagccaccatcgtcatcgcctgctacttctat
gagcaggccttccgggaccagtgggagcgcagctgggtggcccagagctgcaagagctac
gccatcccctgcccccacctccaggcgggtgggggcgccccgcctcacccgcccatgagc
ccagacttcacagtcttcatgatcaagtaccttatgacactgatcgtgggcatcacgtca
ggcttctggatctggtcgggcaagaccctcaactcctggaggaaattctacaccaggctc
accaacagcaaacagggggagaccaccgtctga

KEGG   Loxodonta africana (African savanna elephant): 100658936
Entry
100658936         CDS       T04351                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658936 (FZD7)
   04390 Hippo signaling pathway
    100658936 (FZD7)
   04150 mTOR signaling pathway
    100658936 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100658936 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100658936 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658936 (FZD7)
   05205 Proteoglycans in cancer
    100658936 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100658936 (FZD7)
   05226 Gastric cancer
    100658936 (FZD7)
   05217 Basal cell carcinoma
    100658936 (FZD7)
   05224 Breast cancer
    100658936 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100658936 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    100658936 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658936 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100658936 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100658936 (FZD7)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100658936 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100658936
NCBI-ProteinID: XP_003406180
LinkDB
Position
Unknown
AA seq 572 aa
MRGPGAAASRSPLGLRALVLALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGPTAYPTA
PYLPDLPFTALPPGAADGRGRSTFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVALA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgcggccgcgtcgcgctcgcccctgggcctacgcgccctggtgctg
gcgctgctgggcgcgctgcccgcgggcgccggggcgcagccgtaccacggcgagaagggc
atctcggtgccagaccatggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccaattctacccgctagtgaaggtgcagtgctcgcccgagctgcgcttc
ttcctgtgctccatgtacgcgcccgtgtgcactgtcctcgagcaggccatcccgccgtgc
cgttctctgtgtgagcgcgcccgccagggttgcgaggcgctcatgaacaaattcggcttc
cagtggccggagcggctgcgctgcgagaacttcccggtgcacggcgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggccccggccccacggcctaccccaccgcg
ccctacctgcctgacttgcctttcactgcgctgcccccgggggccgcagacggtaggggc
cgctccaccttccccttctcgtgccctcgccagctcaaagtgcctccctacctgggctac
cgcttcttgggcgagcgcgactgtggcgccccatgcgagcccggccgcgccaacggcctc
atgtactttaaggaggaggagaggcgtttcgcccgcctctgggtgggcgtgtggtcggtg
ctgtgctgcgcttcgacgctcttcacggtgcttacctacctggtggacatgcggcgcttc
agctatcctgagcggcccatcatcttcctgtcgggctgctacttcatggtggccttggca
cacgtggccggcttcctgctggaggaccgcgccgtgtgcgtggagcgcttctcggacgac
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatccttttcatggtg
ctctactttttcggcatggccagctccatctggtgggtcatcctgtcccttacctggttc
ctggcggccggcatgaagtggggccacgaggccattgaggccaactcgcagtacttccac
ctggccgcatgggccgtgcccgccgtcaagaccatcaccatcctggccatgggccaggtg
gatggggacctgctcagcggggtgtgctacgttggcctgtcgagcgtggacgcgctgcgg
ggcttcgtgctggcgcccctgtttgtctacctcttcatcggcacgtccttcctgctggcc
ggcttcgtgtctctgttccgcatccgcaccatcatgaagcacgacggcaccaagaccgag
aagctggagaagctcatggtgcgcatcggcgtctttagcgtgctctacacggtgcctgct
accatcgtgctggcctgctacttttacgagcaggcctttcgcgagcactgggagcgcacc
tggctcctgcagacctgcaagagctacgccgtgccctgcccgcccggccacttcccgccc
atgagccctgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actacaggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttctaccac
agactcagccacagcagcaagggggagactgcggtatga

KEGG   Loxodonta africana (African savanna elephant): 100660631
Entry
100660631         CDS       T04351                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100660631 (FZD10)
   04390 Hippo signaling pathway
    100660631 (FZD10)
   04150 mTOR signaling pathway
    100660631 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100660631 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100660631 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660631 (FZD10)
   05205 Proteoglycans in cancer
    100660631 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100660631 (FZD10)
   05226 Gastric cancer
    100660631 (FZD10)
   05217 Basal cell carcinoma
    100660631 (FZD10)
   05224 Breast cancer
    100660631 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660631 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100660631 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100660631 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100660631 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100660631 (FZD10)
   04090 CD molecules [BR:lav04090]
    100660631 (FZD10)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100660631 (FZD10)
CD molecules [BR:lav04090]
 Proteins
  100660631 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100660631
NCBI-ProteinID: XP_010599098
LinkDB
Position
Unknown
AA seq 473 aa
MCEQARLKCSPIMEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPTRGSGMFPPL
FRPQRPHSSQEQQLKDGASARAGCDNPGKFHHVEKSASCAPLCTPGVDVYWSRDDKRFAV
VWLAVWSVLCFFSSAFTVLTFLIDPHRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESI
ACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIE
ANSSYFHLAAWAVPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLII
GTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLN
MDYWKVLATQHKCRVNNQTKNVDCLMAASIPAVEIFMVKVFMLLVVGITSGMWIWTSKTL
QSWQSVCSRRLKKKSRRKPASVVTSSGIYKKAQHPQKTHHGKYEIPAPPPTCV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtgcgagcaggcccggctcaaatgctccccgatcatggagcagttcaacttcaagtgg
cccgactccctggactgcagcaaactccccaacaagaacgaccccaactacctgtgcatg
gaggcgcccaacaacggctcggacgagcccacgcggggctctggtatgttccctccgctc
ttccggccgcagcggccgcacagctcgcaggagcagcagctcaaggacggggcgtccgcg
cgcgctggctgcgacaaccccggcaagttccaccatgtggagaagagcgcgtcgtgcgcg
ccgctctgcacgcccggcgtggacgtgtactggagtcgcgacgacaagcgcttcgccgtg
gtctggctggctgtctggtccgtgctctgctttttctccagcgccttcacggtgctcacc
ttcctcatcgaccctcatcgcttcaggtaccccgagcgccccatcatcttcctgtccatg
tgctactgcgtctactcggtgggctacatcatccgcctctttgcgggcgcagagagcatc
gcctgcgaccgggacagcgggcagctctatgtcatccaggagggcctggagagcaccggc
tgcacgctggtgttcctggttctctactactttggcatggccagctcgctctggtgggtc
atcctcacgctcacctggttcttggcggccggcaagaagtggggccacgaggccatcgag
gccaacagcagctacttccatctggcggcctgggccgtccccgcggtgaagaccatcctg
atcctggtgatgcgcagggtggcgggggacgagctcaccggcgtgtgctacgtgggcagc
atggacgtcaacgccctcaccggcttcgtgctcatccccctggcctgctacctcatcatc
ggcacctccttcattctctcgggcttcgtggccctcttccacatccggagggtgatgaag
acgggcggggagaacacggacaagctggagaaactcatggtgcgcatcggagtcttctcc
gtgctctacacggtgccggccacctgtgtgatcgcctgctacttctacgaacgcctcaac
atggattactggaaagtcctagccacgcagcacaagtgcagagtgaacaaccagaccaag
aacgtggactgcctgatggccgcctccatccccgccgtggagatcttcatggtgaaggtg
ttcatgctgctggttgtgggtatcaccagcggtatgtggatctggacctcaaagactctg
cagtcctggcagagcgtctgcagccgtaggctgaagaagaagagcaggcggaaacccgcc
agcgtggtcaccagcagtgggatttacaaaaaagcccagcacccgcaaaaaacccatcac
gggaaatacgaaatccccgccccgcctcccacctgtgtgtga

KEGG   Loxodonta africana (African savanna elephant): 100666465
Entry
100666465         CDS       T04351                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100666465 (FZD3)
   04390 Hippo signaling pathway
    100666465 (FZD3)
   04150 mTOR signaling pathway
    100666465 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100666465 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100666465 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100666465 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666465 (FZD3)
   05206 MicroRNAs in cancer
    100666465 (FZD3)
   05205 Proteoglycans in cancer
    100666465 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100666465 (FZD3)
   05226 Gastric cancer
    100666465 (FZD3)
   05217 Basal cell carcinoma
    100666465 (FZD3)
   05224 Breast cancer
    100666465 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666465 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100666465 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100666465 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100666465 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100666465 (FZD3)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100666465 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100666465
NCBI-ProteinID: XP_003412505
UniProt: G3T897
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFYLWALAMFVGCISGHSSFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSSNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctatctttgggccttggctatgtttgtgggatgcata
agtgggcatagttcgttttcttgtgaacctattaccttgagaatgtgccaagatttgcct
tataatactaccttcatgcctaatcttttgaatcattatgaccaacaaacagcagcttta
gcaatggagccattccaccctatggtgaacctggattgctctcgggatttccggccattt
ctttgtgcactctacgctcctatttgtatggaatacggacgtgtcacacttccttgtcgt
aggctatgtcagcgggcctacagtgagtgttcgaagctcatggaaatgtttggtgttcct
tggcctgaagatatggaatgtagtaggtttccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggagaccctacggaaggagccccagtggcagtgcagagggac
tatggcttttggtgtccccgagagttgaaaattgatcctgaccttggttattcttttttg
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttca
tttgctcgatatttcataggactgatttcaatcatttgcctctctgccacattgtttact
tttttaacttttttgattgatgttacaagattccgctatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttactcgaggat
cgagtagcctgcaatgcatctagccctgcccagtataaggcttccacagtgacacaagga
tctcacaataaagcctgtaccatgctttttatggtactctatttctttactatggctggc
agcgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggc
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccctgga
actctaactatcatcctgttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctatatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccgttagaaaaggaaaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctttatcttgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatttgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtcctgacctgatccttttt
ctgatgaaatacctgatggcactcatagtcggtattccctccattttttgggttggaagc
aagaaaacatgttttgaatgggccagttttttccatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtccctcctaagagatccg
aatactcctattataagaaaatcaagaggaacatccactcaaggaacatccacacatgct
tcttcaactcaactggctatggtggatgatcagagaagcaaagcaggtagtgtccacagc
aaagtgagcagctaccatggcagcctccacagatcacgtgatggcaggtacactccctgc
agttacaggggaatggaggaaagactacctcatggcagcatgtcacgactaacagatcac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtagtaatcccatgactcacatcacacatggcacaagtatgaatcgggttattgaa
gaagacggaaccagcgcttaa

KEGG   Loxodonta africana (African savanna elephant): 100666499
Entry
100666499         CDS       T04351                                 

Gene name
FZD8
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100666499 (FZD8)
   04390 Hippo signaling pathway
    100666499 (FZD8)
   04150 mTOR signaling pathway
    100666499 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100666499 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100666499 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100666499 (FZD8)
   05205 Proteoglycans in cancer
    100666499 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100666499 (FZD8)
   05226 Gastric cancer
    100666499 (FZD8)
   05217 Basal cell carcinoma
    100666499 (FZD8)
   05224 Breast cancer
    100666499 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100666499 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    100666499 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100666499 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100666499 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100666499 (FZD8)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100666499 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 100666499
NCBI-ProteinID: XP_023395552
LinkDB
Position
Unknown
AA seq 553 aa
MEWSYLLEVTSLLAAFALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRWDRLPEXGNPDTLCMDWRRISNPVAAHHLFLACYLFVSVGYLVRLV
AGHEKVACSGGAPGPGGAGPAGGAAAAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYE
TTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVP
SVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFR
IRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPC
LRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGGGGGPGGGGGSLYSDVSTGLTWRSGTAS
SVSYPKQMPLSQV
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggagtggagttacctgttggaagtgacctcgctgctggccgccttcgcgctgttgcag
cgctcgagcggcgcggcggccgcctcggccaaagagctggcgtgccaggagatcacggtg
cccctgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccactggtagagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaagactac
aaaaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgggaccggctgccggag
ncaggcaaccccgacacgttatgcatggactggagacgtataagtaacccggtagcggcc
catcatttgttcttagcctgctacctcttcgtgtcggtaggctacctggtgcgcctagtg
gcaggccacgagaaggtggcgtgcagcggcggcgcgcccggcccgggcggcgcgggacct
gcgggcggtgcggcggcggcggcggcgggcgcgggcgcagcgggagcgggcgcgggcggc
ccgggcgggcgcggcgagtacgaggaactgggcgccgtggagcagcacgtgcgctacgag
accacgggcccggccctgtgtactgtcgtcttcctgctggtctacttcttcggcatggcc
agctccatctggtgggtgatcctgtcgctcacgtggttcctggcggccggcatgaagtgg
ggcaacgaggccatcgccggctactcgcagtacttccacctggccgcgtggctcgtgccc
agcgtcaagtccatcgccgtgctggcgctcagctcggtggacggggacccggtggcgggc
atctgctacgtgggcaaccagagcctcgacaacctgcgcggcttcgtgctggcaccgctg
gtcatctacctcttcatcggcaccatgtttctgctggcgggcttcgtgtcgctcttccgc
atccgctcggtcatcaagcagcagggcgggcccaccaagacgcacaagctggagaagctc
atgatccgcctgggcctcttcaccgtgctctacaccgtgcccgccgccgtcgtggtcgcc
tgcctcttctacgagcagcacaaccgcccgcgctgggaggccacgcacaactgcccgtgc
ctgcgggacctgcagcccgaccaggcccgtcggcctgactacgccgtgttcatgctgaag
tacttcatgtgcctcgtggtgggcatcacctcgggcgtgtgggtctggtctggcaagacg
ctcgagtcctggcgcgccctgtgcacccgctgctgctgggccagcaagggcnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnncccggcgggggcgggggaccgggcggcggc
gggggctccctctacagcgacgtcagcaccggcctgacgtggaggtctggcacggccagc
tccgtgtcttaccccaagcagatgccattgtcccaggtctga

KEGG   Loxodonta africana (African savanna elephant): 100674586
Entry
100674586         CDS       T04351                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100674586 (FZD5)
   04390 Hippo signaling pathway
    100674586 (FZD5)
   04150 mTOR signaling pathway
    100674586 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100674586 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100674586 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100674586 (FZD5)
   05205 Proteoglycans in cancer
    100674586 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100674586 (FZD5)
   05226 Gastric cancer
    100674586 (FZD5)
   05217 Basal cell carcinoma
    100674586 (FZD5)
   05224 Breast cancer
    100674586 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100674586 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100674586 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100674586 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100674586 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100674586 (FZD5)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100674586 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100674586
NCBI-ProteinID: XP_023397773
LinkDB
Position
Unknown
AA seq 585 aa
MARLDPSAPPPLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLEDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFTAKPTHPGLPGAPASGV
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
RRRGHKSGGARAAADYAEASAALTSRTGPLGPAAAYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcttgacccgtccgcaccgcccccgctgctgctgctgctcctggcgcagctg
gtgggccgggcggcggccgcctccaaggccccggtgtgccaggagatcacggtccccatg
tgccgcggcatcggctacaacttgacgcacatgcccaaccagttcaatcacgacacgcag
gacgaggccggcctggaggtgcaccagttctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcttggaagactaccacaag
cctctgccgccctgccgctccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggccggagcgcatgagctgcgaccgcctcccagtcctgggc
cgcgatgccgaggtcctgtgcatggattacaaccgcagtgaggctaccacggcgcccccc
cggcccttcacggccaagcccacacacccaggcctgccaggggcgccagcctccggggtc
gagtgtgccgccgggggcccgtcggtgtgcaagtgccgcgaaccattcgtgcccatcctg
aaggagtcgcaccccctgtacaacaaggtgcggacgggccaggtgcccaactgcgcggtg
ccttgctatcagccgtccttcagccccgacgagcgcacgttcgccaccttctggattggc
ctgtggtcggtgctgtgcttcatctccacctccaccacggtggccaccttcctcatcgac
atggagcgcttccgataccccgagcgccccatcatcttcctgtccgcctgctacttatgc
gtgtcgctgggtttcctggtgcgcctggttgtgggccatgccagtgttgcatgcagccgc
gagcacagccacatccactacgagactaccggcccagcattgtgcaccgtcgtcttcctg
cttgtctacttcttcggcatggccagctccatctggtgggtcatcctgtcactcacctgg
ttcctggcggctggcatgaagtggggcaacgaggcgatcgcgggctatgcacagtacttc
cacctggctgcttggctcatccctagcgtcaagtccattacggcgttggcgctgagctct
gtagacggtgacccggtggctggcatctgctacgtaggcaaccagaacctgaactcgttg
cgtggcttcgttctgggcccgctggtgctctacctgctcgtgggcacgctcttccttctg
gcgggctttgtgtcgctcttccgcatccgtagtgtcatcaagcagggcggcaccaagacg
gacaaactggagaagctcatgatccgcataggcattttcacgctactgtacacagtgccc
gccagcatcgtggtggcctgctacctgtatgagcagcactaccgcgagagctgggaggcg
gccctcacctgcgcgtgcccgggccccgacgccggccagccgcgcgccaagccggagtac
tgggtgctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atctggtccggcaagacggtggagtcgtggcggcgcttcaccagccgctgctgctgccgt
cggcggcggggccacaagagcggcggcgccagggccgcggcggactacgccgaggcgagc
gcggcactgacgagcaggaccgggccgctgggccccgccgccgcctaccacaagcaggtg
tccctgtcgcacgtgtag

KEGG   Loxodonta africana (African savanna elephant): 100675317
Entry
100675317         CDS       T04351                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100675317 (FZD4)
   04390 Hippo signaling pathway
    100675317 (FZD4)
   04150 mTOR signaling pathway
    100675317 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100675317 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100675317 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675317 (FZD4)
   05205 Proteoglycans in cancer
    100675317 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100675317 (FZD4)
   05226 Gastric cancer
    100675317 (FZD4)
   05217 Basal cell carcinoma
    100675317 (FZD4)
   05224 Breast cancer
    100675317 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675317 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100675317 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100675317 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100675317 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100675317 (FZD4)
   04090 CD molecules [BR:lav04090]
    100675317 (FZD4)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100675317 (FZD4)
CD molecules [BR:lav04090]
 Proteins
  100675317 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100675317
NCBI-ProteinID: XP_003418598
UniProt: G3UE67
LinkDB
Position
Unknown
AA seq 536 aa
MGRRGAGPRVPGEPGGVGLSLRLLLLLLLLGPARGFGDEEERRCDPIRITMCQNLGYNVT
KMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMC
LSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEC
HSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTF
LIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTG
CAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIV
ILIMRLVDADGLTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQ
KDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKI
FMSLLVGITSGMWIWSAKTFHTWQKCSNRLVNSGKVKREKRGSGWVKPGKGNETVV
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggccggcggggcgcggggccgagagtcccgggggagcccgggggcgtcgggctgagt
ctgcggctgctgctgctgctgctgctcttggggccggcgcggggctttggggacgaggag
gagcggcgctgcgaccccattcgcatcaccatgtgccagaacctcggctacaacgtgacc
aaaatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgacaacc
ttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcggtt
tatgtgccaatgtgcacagagaagatcaacatccccatcggcccatgcggcggcatgtgt
ctttcagtcaagagacgctgtgaaccggtcctgaaggaatttggattcgcctggccagag
agcctgaactgcagcaaattcccaccacagaatgaccacaatcacatgtgcatggaaggg
ccaggtgacgaagaggtacctttacctcacaaaacccccatccagcctggggaagaatgt
cactctgtgggaaccaattctgaccagtacatctgggtgaaaaggagcctgaactgtgtt
ctcaagtgtggctatgatgccggtttatacagccgctcggccaaggagttcaccgacatc
tggatggccgtgtgggccagcctgtgcttcatctccaccgccttcacggtcctgaccttc
ctgatcgattcctccaggttttcctaccctgagcgccccatcatatttctcagtatgtgc
tataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggatatcc
tgcgattttgaagaggcagcagaacccgttctcatccaagaaggacttaagaacacagga
tgtgcaataattttcttgctgatgtacttttttggaatggctagctctatctggtgggtt
attctgacactcacttggtttttggcagccggactcaaatggggtcatgaagccattgaa
atgcacagttcttatttccacattgcagcctgggccatccctgcggtgaaaaccattgtc
atcttgatcatgagactggtggatgcagatggactgactggcctgtgctatgttggaaac
caaaaccttgatgccctcactggctttgtggtggctcccctcttcacttatttggtgatc
ggaactttattcattgctgcaggtttggtggccttgttcaaaattcggtcaaatcttcaa
aaggatgggacaaagacagacaagttggaaaggctgatggtcaaaattggagtcttctca
gtactgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatttccaac
tgggcactcttccggtattctgcagatgactccaatatggcagttgaaatgttaaaaatt
tttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaaactttt
cacacgtggcagaaatgttccaacagattggtgaactctgggaaggtaaagagagagaag
agagggagtggttgggtaaagcctgggaaaggcaatgaaactgtggtataa

KEGG   Loxodonta africana (African savanna elephant): 100677440
Entry
100677440         CDS       T04351                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100677440 (FZD6)
   04390 Hippo signaling pathway
    100677440 (FZD6)
   04150 mTOR signaling pathway
    100677440 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100677440 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100677440 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100677440 (FZD6)
   05205 Proteoglycans in cancer
    100677440 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100677440 (FZD6)
   05226 Gastric cancer
    100677440 (FZD6)
   05217 Basal cell carcinoma
    100677440 (FZD6)
   05224 Breast cancer
    100677440 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100677440 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100677440 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100677440 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100677440 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100677440 (FZD6)
G protein-coupled receptors [BR:lav04030]
 Frizzled / Smoothened family
  100677440 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 100677440
NCBI-ProteinID: XP_003408475
UniProt: G3SS79
LinkDB
Position
Unknown
AA seq 712 aa
MEMFTFLLCIFLPLIRGHSLFTCEPITVPRCVKMAYNMTFFPNLMGHYDQGTAAKVMEHF
LPLANLECSPNVETFLCKAFVPSCTEQIHVVPPCRKFCEKVYSDCKKIIDTFDIQWPEEL
ECDRLQYCDETVPTTSDPPTKFLDPQKKTEEVQRDIGFWCPRHLKTSGGQGYKFLGLDQC
APPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVCY
SIVSLMYFIGFLLGNSTACNKADEKLELGDTVILGSQNKACTVLFMFLYFFTMAGTVWWV
ILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGVPGFLTVMLLAMNKVEGDNISGVCFVGL
YDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFS
GLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTTARPELALFMIKYL
MTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKK
KHYKPSSHKLKVISKSMGTSTGATANHGASAVAITNHDYLGQETLTEIQTSPETSVRDMG
ADGASTPKLREQDCGDPSSPAASSSKLSGEQANRKGRKAANVNDKSSVSESVRSEGRVNP
KNDFTETVPVQSNNLQMPSSSQPSSLKGSTSLLVHSVSGVRKEQDAGSHSDA
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggagatgtttacatttttgctatgtatttttctacccctcataagagggcatagtctc
ttcacctgtgaaccgattactgttcccaggtgtgtgaaaatggcctacaatatgacattt
ttccctaatctgatgggtcattatgaccagggtactgctgctaaggtaatggagcatttt
cttcctctcgcaaatctggaatgttcaccaaatgttgaaactttcctttgtaaagcgttt
gtaccaagctgcacagaacaaattcatgtggttccaccttgccgtaaattttgtgagaaa
gtatattctgattgcaaaaaaataattgacacttttgacatccaatggcctgaggaactt
gaatgtgacagattacaatactgtgatgagacagttcctacaacttctgatccacccaca
aaatttcttgaccctcagaagaaaacagaagaagtccaaagagacattggattttggtgt
ccaagacatctcaagacctctggaggacaaggctataagtttctgggccttgaccagtgt
gcgcctccttgtcccaacatgtattttaaaagtgatgagctagagtttgcaaaaagtttt
atcggaatagtttccatattctgtctttgtgcaactttgttcacatttctgactttttta
attgatgttaaaagatttagatacccagagagaccaattatatattactccgtctgttac
agcattgtatcgcttatgtactttattggctttttgctcggcaatagtacagcctgtaat
aaggcagatgaaaagctagagcttggtgacacagttattctaggctctcagaataaggct
tgcactgttttatttatgtttttgtattttttcacaatggctggcactgtgtggtgggtg
attcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccattgaa
caaaaagcagtgtggttccatgccgtcgcgtggggagtaccaggttttctaactgttatg
cttcttgctatgaacaaagttgaaggagataatatcagtggagtttgctttgttggcctt
tatgacctggatgcttctcgttactttgtactcttgccactgtgcctttgtgtgtttgtt
ggcctttctcttcttttagctggaattatttctttaaatcatgttcgacaagttatacaa
catgatggtcgaaaccaagagaaactaaaaaaatttatgattcggattggagttttcagt
ggcctgtatcttgtaccattagtgacacttcttggatgttatgtctatgagcaagtgaat
agaattacctgggagataacttgggtctctgatcattgtcgtcagtaccatatcccatgc
ccttatcaggcaaaaacaacagctcgaccagaattggctttatttatgataaaatatctg
atgacattaattgttggcatctctgctgtcttctgggtcggaagcaaaaagacgtgcaca
gaatgggctggtttttttaaacgaaatcgcaagagagatccaatcagtgaaagtcgaaga
gtactacaggagtcatgtgagtttttcttaaagcacaattctaaagtgaaacacaaaaag
aagcactacaaaccaagttcacataagctgaaagtcatttccaaatccatgggaaccagc
acaggagctacagcaaatcatggcgcttctgctgtagcaatcactaaccatgattattta
ggacaagaaactcttacagaaatccagacctcaccagaaacatcagtgagagacatggga
gcggatggggcaagcactcccaaattaagagaacaggactgtggtgacccttcctcccca
gcagcatccagttccaaactctctggggagcaggccaacagaaaaggaaggaaggcggcg
aatgtgaacgataagagcagcgtgtctgaaagtgtgcggagtgaaggaagggtaaatcca
aaaaatgattttactgaaactgtcccagtgcagagcaacaacttgcagatgcccagttcg
tcacagcctagcagcctcaaaggttccacgtcactgcttgttcactcggtttcgggagtt
agaaaagagcaggatgcgggcagtcactcagatgcttga

DBGET integrated database retrieval system