KEGG   Loxodonta africana (African savanna elephant): 100655007
Entry
100655007         CDS       T04351                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04912  GnRH signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655007 (MAP2K4)
   04012 ErbB signaling pathway
    100655007 (MAP2K4)
   04668 TNF signaling pathway
    100655007 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100655007 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100655007 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100655007 (MAP2K4)
   04926 Relaxin signaling pathway
    100655007 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100655007 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100655007 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100655007 (MAP2K4)
   05135 Yersinia infection
    100655007 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655007 (MAP2K4)
   05161 Hepatitis B
    100655007 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655007 (MAP2K4)
   05169 Epstein-Barr virus infection
    100655007 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100655007 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655007 (MAP2K4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100655007 (MAP2K4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100655007 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 100655007
NCBI-ProteinID: XP_023412247
LinkDB
Position
Unknown
AA seq 338 aa
MDTEEQLQWCAGERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVH
KPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELM
STSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSG
NIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELA
TGRFPYPKWNSVFDQLTQVVKGDPPQLTNSEEREFSPSFINFVNLCLTKDESKRPKYKEL
LKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggacacagaagaacagttgcagtggtgtgcaggagagagactgagaacacacagcatt
gaatcgtcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggac
ttgaaagaccttggagaaattggacgcggagcttatggttctgtcaacaaaatggtccac
aaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaagaa
caaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatatatt
gttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggagctcatg
tctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttattccc
gaagagattttaggaaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaa
aacttgaaaatcattcacagagatatcaaaccttccaatattcttctggacagaagtgga
aatattaaactctgtgacttcggcatcagtggacagcttgtggattccattgccaagaca
agagatgcagggtgtaggccatacatggcgcctgaaagaatagacccaagtgcatcacga
caaggatatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggcc
acaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtcgtg
aaaggagatcctccacagctgactaattctgaggaaagggaattctccccaagtttcatc
aactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagaactt
ctgaaacatccctttatcttgatgtatgaagaacgtaccgtagaggtcgcatgctatgtt
tgtaaaatcctggatcaaatgccggctactcccagctctcccatgtatgtcgattga

KEGG   Loxodonta africana (African savanna elephant): 100662511
Entry
100662511         CDS       T04351                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04218  Cellular senescence
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05145  Toxoplasmosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662511 (MAP2K6)
   04015 Rap1 signaling pathway
    100662511 (MAP2K6)
   04668 TNF signaling pathway
    100662511 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100662511 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100662511 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100662511 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100662511 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    100662511 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100662511 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100662511 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100662511 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100662511 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    100662511 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100662511 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100662511 (MAP2K6)
   05135 Yersinia infection
    100662511 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100662511 (MAP2K6)
   05161 Hepatitis B
    100662511 (MAP2K6)
   05163 Human cytomegalovirus infection
    100662511 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100662511 (MAP2K6)
   05169 Epstein-Barr virus infection
    100662511 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100662511 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100662511 (MAP2K6)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100662511 (MAP2K6)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100662511 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 100662511
NCBI-ProteinID: XP_003417334
UniProt: G3UEC7
LinkDB
Position
Unknown
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKSQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKATDVATFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaagatccccaaagaagcattt
gaacaacctcagaccagttccacgccacctcgagatttagactctaaggcttgcatttct
attggaaatcagaactttgaagtgaaggctgatgacctagagcctataatggaactgggg
cgaggggcgtacggcgtggtggagaagatgcggcatgtgcccagtgagcagatcatggcg
gtgaagcggatccgggccacagtaaatagccaggagcagaaaaggctactgatggatttg
gatatttccatgaggacagtggactgtccttttacagtcaccttttatggcgcactcttc
cgggagggtgatgtgtggatttgcatggagctcatggatacatcactagataaattctat
aagcaagtcatcgataaaagccaaacgattccagaggacatcttagggaaaatagcagtt
tctattgttaaggcattagaacacttacacagtaagctgtctgtgattcatcgagacgtc
aagccttcgaacgtgctgatcaatgctctgggccaagtgaagatgtgtgattttggaatc
agcggctaccttgtggactctgttgctaaaacgatcgacgcaggctgcaaaccctacatg
gctcctgaacgaataaacccagagctcaaccagaagggatacagtgtgaaatctgacatt
tggagtcttggcatcacaatgattgagttggccatcctccggtttccctatgattcatgg
ggaaccccctttcagcagctcaaacaggtggtagaagagccatcgccacagctcccagca
gacaagttctccgcagagtttgttgactttacctcacagtgcttgaagaagaattccaaa
gaaaggccaacgtatccagagcttatgcaacatccttttttcaccctacacgaatccaaa
gcaacagatgtggcaacttttgtaaaactgattcttggagactaa

KEGG   Loxodonta africana (African savanna elephant): 100675607
Entry
100675607         CDS       T04351                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X1
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04218  Cellular senescence
lav04620  Toll-like receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04714  Thermogenesis
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05145  Toxoplasmosis
lav05161  Hepatitis B
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675607 (MAP2K3)
   04015 Rap1 signaling pathway
    100675607 (MAP2K3)
   04668 TNF signaling pathway
    100675607 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100675607 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100675607 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    100675607 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675607 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    100675607 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675607 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100675607 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100675607 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100675607 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    100675607 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100675607 (MAP2K3)
   05135 Yersinia infection
    100675607 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100675607 (MAP2K3)
   05161 Hepatitis B
    100675607 (MAP2K3)
   05169 Epstein-Barr virus infection
    100675607 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100675607 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100675607 (MAP2K3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100675607 (MAP2K3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100675607 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 100675607
NCBI-ProteinID: XP_010598520
UniProt: G3U6S9
LinkDB
Position
Unknown
AA seq 347 aa
MESPASSQPPSAPQSKGKSRKKKDLRITCVSKPPPPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgcctcgagccagccccccagcgcgccccagtccaaaggaaaatccagg
aagaagaaggacttacggataacctgtgtgtccaagcctccaccacccaaccccacgccc
ccccggaaccttgattccaggaccttcatcaccataggagaccggaacttcgaggtggaa
gccgatgacctggtgaccatctcggagctgggccgtggagcctatggggtagtggagaag
gtgcgacatgcccagagtggtaccatcatggctgtgaagcggattcgagccaccgtgaac
tcacaggagcagaagaggctgctcatggacttggacatcaacatgcggacagttgactgc
ttctacactgtcaccttctacggggccctcttcagagagggtgatgtgtggatctgtatg
gagcttatggacacctctctggataaattctaccggaaggtgctggacaaaaacatgaca
attccagaggatattttgggggagattgctgtgtcgattgtgagggccctggagcacctg
cacagcaaactctccgtgatccacagagacgtgaagccctccaatgtgctcatcaacaag
gagggccatgtgaagatgtgcgactttgggattagtggctacttggtggactccgtggct
aagactatggacgccggctgcaagccctacatggcccctgagagaatcaacccggagctg
aaccagaagggctacaatgtcaagtccgatgtctggagcctcggcatcacaatgattgag
atggccatcctgcggtttccttatgagtcctgggggaccccgttccaacagctgaagcag
gtggtagaggagccgtccccccagctcccagctgaccggttctctcctgagtttgtggac
ttcactgcacagtgcctgaggaagaaccccgcggagcgcatgagctacctggagctgatg
gagcaccctttcttcaccttgcacaaaaccaagaagacagacattgctgccttcgtgaag
gagatcctgggggaggactcgtag

DBGET integrated database retrieval system