KEGG   Loxodonta africana (African savanna elephant): 100655036
Entry
100655036         CDS       T04351                                 

Gene name
DCTN2
Definition
(RefSeq) dynactin subunit 2 isoform X2
  KO
K10424  dynactin 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100655036 (DCTN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100655036 (DCTN2)
   05016 Huntington disease
    100655036 (DCTN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100655036 (DCTN2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100655036 (DCTN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100655036 (DCTN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100655036 (DCTN2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     100655036 (DCTN2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     100655036 (DCTN2)
SSDB
Motif
Pfam: Dynamitin PI_PP_I ZapB PRD
Other DBs
NCBI-GeneID: 100655036
NCBI-ProteinID: XP_010596593
UniProt: G3TBH4
LinkDB
Position
Unknown
AA seq 403 aa
MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDK
RVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKI
KTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQ
LEATKNTKGTGSGGKTSNGALPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATL
RCDQDTQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKA
SVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLITIKQLHEQAMQFGQLLTHLDTTQQ
MIASSLKDNTTLLTQVQTTMRENLATVERNFASIDDRMKRLGK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcggaccctaaatacgccgaccttcccggcattgccaggaacgagccagatgtttat
gagaccagtgacctacctgaggatgatcaagcggagtttgatgcggaggagctgacgagc
acaagcgtggagcacatcattgtcaatcccaatgctgcctatgacaagttcaaggacaag
agagtggggacaaagggacttgatttctcagatcgtattggaaaaaccaagaggacagga
tatgaatctggagactatgagatgcttggagagggcctgggagtaaaggagacaccccag
caaaagtaccagcgactactacatgaggtccaagagctgacgactgaagttgagaaaatc
aagacaacagtgaaggagtcagccactgaggagaagctgacccctgtggtactggctaaa
cagctggcagccctgaagcagcagttggttgcttcccacctggagaagctgctgggacca
gatgctgcgatcaacctcactgaccctgatggggctctggcaaagcgcctgctgctgcag
ctggaagcaacaaagaacaccaaaggcactggttcagggggaaagacctccaatggggcc
cttccagatagcagccttgtcacttatgaactacattctcggcctgagcaggacaaattc
tctcaagctgccaaagttgcggaacttgagaagcgactgacagagctggaggcaactcta
cgctgtgatcaggatactcagaatcccctttcagcaggtctccagggagcctgtcttatg
gagacagtagagctgttgcaagcaaaggtgagcgccctggaccttgcagttttggaccaa
gtggaggctcggctacagagtgtcctgggaaaggtgaatgagattgccaagcataaagcc
tctgtagaggatgcagatacacaaagtaaggtgcaccagctatatgaaaccatacagcgc
tggagccctatcgcctccacccttcctgagctggtgcagagactcatcaccatcaaacag
ttgcacgagcaagccatgcagtttggtcagctcctgacacacttggataccacccaacag
atgattgctagttccctcaaggacaataccactctcttgacccaggtgcagacgaccatg
cgtgaaaatctggccacagtcgagaggaactttgccagcattgatgaccggatgaagagg
ctgggaaagtga

KEGG   Loxodonta africana (African savanna elephant): 100656316
Entry
100656316         CDS       T04351                                 

Gene name
DCTN1
Definition
(RefSeq) LOW QUALITY PROTEIN: dynactin subunit 1
  KO
K04648  dynactin 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100656316 (DCTN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100656316 (DCTN1)
   05016 Huntington disease
    100656316 (DCTN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100656316 (DCTN1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656316 (DCTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100656316 (DCTN1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100656316 (DCTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100656316 (DCTN1)
Membrane trafficking [BR:lav04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    100656316 (DCTN1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     100656316 (DCTN1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     100656316 (DCTN1)
SSDB
Motif
Pfam: Dynactin CAP_GLY Filament
Other DBs
NCBI-GeneID: 100656316
NCBI-ProteinID: XP_023408556
LinkDB
Position
Unknown
AA seq 1244 aa
MSAEASARPLRVGSRVEVIGKGYRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRK
YFTCDEGHGIFVRQSQIQIFEDGADTTSPETPDSSASKVLKREGTDAAAKTSKLPTRPAS
TGVAGASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAAPPLLSPSKEE
EGLRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLK
EARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTT
DLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEK
KNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVREL
RETVGDLEAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTI
KKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQME
VAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELIRKQAQEKFELSENCS
ERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCGVDVYKKVGSLYPEMSAHER
SLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSAL
DCMSVEVGRLRAFLQSGQEASDIALLLRDLETSCSDTRQFCKKIRRRMPGTDAPGIPAAV
AFGAQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLPVATLEELAFKANEQI
YGSSSSTPYECLRQSCSVLISTMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITD
AEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDADERIDRVQTR
LEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKLRLNSQSKRTIEGLRGPPPSGIA
TLVSGIAGEEQQRAGAPGQAPGSVAGPGLVKDSPLLLQQISAMRLHISQLQHENSVLKGA
QMKAALAALPPLHVAKVSLPPHEGPGGDIAAGALYRKTSQLLETVNQLSTHTHVVDITRT
SPAAKSPSAQLLEQVAQLKSLSDTIEKLKDEVFKETVSQRPGATVPTDFATFPSSAFLRA
KEEQQEDTVYVGKVTFSCAAGLGQRHRLVLTQEQLRRLHGRLIS
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgagcgcagaggcaagcgcccggcctctgcgagtgggctcccgtgtggaggtgattgga
aaaggctaccgaggcactgttgcctatgttggagccacactcttcgccactggcaaatgg
gtaggcgtgatcctggatgaagcaaagggcaagaatgatggaaccgtccaaggcaggaag
tacttcacatgtgacgaagggcatggtatctttgtgcgccagtcccagatccagatattt
gaagatggagcagacaccacttccccagagacaccagattcttctgcctcaaaggtcctc
aaaagagagggaactgatgcagctgcaaagaccagcaaactgcccactcgcccagccagc
actggggtggctggggccagtagctccctgggcccctctggctcagcatctgcaggtgag
ctgagcagcagcgagcccagcaccccagctcagactccgctggcagcacccatcatcccc
acgccggtcctcacctcccctggagcagcccccccacttctgtccccctccaaggaggag
gaggggctgcgagcccaggtgcgggatctggaggagaagctggagaccctacgtctgaaa
cgggcagaagacaaggcaaagctgaaagagctggagaaacacaagatccagttggagcag
gtgcaggaatggaagagcaaaatgcaggagcagcaggcggacctgcagcggcgcctcaag
gaggcgcggaaggaagccaaggaggcgctggaggcaaaggagcgctacatggaggagatg
gctgacactgccgatgccatcgagatggccactctggacaaggagatggctgaagagcgg
gctgaatccttgcagcaggaggtggaggcactgaaggagcgggtggacgagctcaccact
gacttagagatcctcaaggctgagattgaagagaagggctcagatggggctgcgtccagt
taccagctcaagcagctcgaggagcagaatgcccgcctaaaggatgccctggtgaggatg
cgggatctttcttcctcagagaagcaggagcatgtgaagctccagaaactcatggaaaag
aagaaccaagagttggaagttgtgaggcaacagcgagagcgtctacaggaggagctgagc
caggcagagagcaccattgatgagctcaaggagcaggtggatgctgctctgggagccgag
gagatggtggagatgctgacagaccggaacctgaatctggaagagaaagtgcgggagttg
agagagaccgtgggggacttggaagcaatgaatgagatgaatgatgagctacaggagaac
gcgcgtgagacagaactggagctgcgggagcagctggacatggcaggtgcccgggtgcgc
gaggcccagaaacgcgtggaggcagcccaggagacagttgcagactaccagcaaaccatc
aagaaataccgccagctgactgcccacctacaggatgtgaatcgggagctgacaaaccag
caggaagcatctgtggaaaggcagcagcagccacctccagagacttttgacttcaaaatc
aagtttgctgagactaaggcccatgctaaggcaattgagatggagttgaggcagatggag
gtggcccaggccaaccggcacatgtccctgctgacagccttcatgcccgacagcttcctt
cggccaggtggggaccatgactgtgtcctggtgctgctgctcatgccccgtctcatttgc
aaggccgagttgatccggaaacaggcccaggagaagtttgaactaagtgaaaactgttca
gagcggcccgggctgcgaggagctgcgggggaacagctcagttttgctgctgggctggtg
tactcgctgagcctgctgcaggccacactacaccgctacgagcatgccctctctcagtgt
ggtgtggatgtgtataagaaggtgggtagcctgtaccctgagatgagtgcccatgagcgc
tccttggatttcctcattgagctgctgcacaaggatcagctggacgagacagttaacgtg
gagcctctcaccaaggccatcaagtactaccagcatctgtatagcatccaccttgccgaa
cagcctgaggactgtaccatgcagctggccgaccacattaagttcacccagagtgccctg
gactgcatgagcgtggaggtgggacggctgcgtgcctttctgcaaagtgggcaggaggct
tcagatatcgccctcctgctccgggacctggaaacatcgtgcagcgacacccgccagttc
tgtaagaagatccggaggcggatgccagggacggatgctcctgggattccagctgctgtg
gcctttggagcacaggtatctgacacactcctagactgcaggaaacacctgacgtgggtg
gtggccgtgctgcaggaggtggcagctgctgccgcccagctcattgccccgctggcagag
aacgaggggctgcctgtagctaccctggaggagctggctttcaaagcaaatgagcagatc
tacgggagctcctctagcaccccctatgagtgtctgcgccagtcgtgcagcgtcctcatc
agcacaatgaacaagctggccacagccatgcaggagggggagtacgacgccgagcggccc
cccagcaagcctcccccggttgagctgcgggccgctgcccttcgtgccgagatcacggat
gctgaaggcctgggcttgaagcttgaagatcgagagacggttatcaaggagctgaagaag
tcactcaagatcaagggagaagaactgagtgaggccaatgtacggctcagcctcctggag
aagaagctggacagtgctgccaaagatgcggacgagcggatcgacagagtccagactcgg
ctagaggagacccaggcgctgctgcggaagaaggagaaagaatttgaggagacgatggat
gctctccaggctgacatcgaccagctggaagcagagaaggcggagctaaagctgcgactg
aacagccagtccaagcgcaccatcgaggggctccgggggccccctccctcaggcatagct
accctcgtttctggcatcgctggtgaagaacagcagcgagcaggagcccctgggcaggct
ccgggctccgtggcaggcccaggcctggtgaaggactcaccactgctgcttcagcaaatc
tctgccatgaggctgcacatctcccagctccagcatgagaacagcgtcctcaagggagcc
cagatgaaggcagccttggcagccctaccccctttgcatgtggcaaaggtgtccctccca
cctcacgaaggccctggcggtgatatagcagctggagcactctatcgtaagaccagccag
ctgctggagacagtgaatcagctgagcacgcacacccacgtggtagacatcacccgcacc
agccccgctgccaagagcccatcggcccagctcctggagcaggtggctcagctcaagtcc
ctaagtgacaccatcgagaagctcaaggatgaggtcttcaaggagacggtatctcagcgc
cctggagccacagtccccactgactttgccaccttcccttcctcagccttcctcagggcc
aaggaggagcagcaggaagacacagtctacgtgggcaaagtgaccttctcatgtgcagct
ggccttggacagcgacaccggctggtgctgacccaggagcagctgcgccggcttcacggc
cgcctcatctcctga

KEGG   Loxodonta africana (African savanna elephant): 100670622
Entry
100670622         CDS       T04351                                 

Gene name
DCTN6
Definition
(RefSeq) dynactin subunit 6
  KO
K10428  dynactin 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100670622 (DCTN6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100670622 (DCTN6)
   05016 Huntington disease
    100670622 (DCTN6)
   05022 Pathways of neurodegeneration - multiple diseases
    100670622 (DCTN6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670622 (DCTN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100670622 (DCTN6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670622 (DCTN6)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     100670622 (DCTN6)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     100670622 (DCTN6)
SSDB
Motif
Pfam: Hexapep
Other DBs
NCBI-GeneID: 100670622
NCBI-ProteinID: XP_003412602
LinkDB
Position
Unknown
AA seq 190 aa
MAEKTQKSVKIAPGAVVCVESEIKGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDTEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVVLT
SGCIIGACCSLNTFEVIPENTVIYGAGCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
TKGSSTPVKN
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcggagaagactcaaaagagtgtgaagattgctcctggagcagttgtgtgcgtagaa
agtgaaatcaaaggagatgtaacgataggacccaggacagtgatccaccctaaagcacgg
atcattgcagaagccgggccgatagtgattggtgaaggcaacctaatagaagaacaggcc
cttatcataaatgctcaccccgataatatcacccctgacgctgaagacacagaacccaaa
ccaatgatcattggcaccaataatgtgtttgaagttggctgttattctcaagccatgaaa
atgggagataataatgttatcgaatcaaaagcgtacgtgggcagaaacgtcgtattgacg
agcggctgtatcattggcgcctgttgcagcctgaatacttttgaggtcatccctgagaat
actgtgatctacggtgcaggctgccttcggcgagtgcagactgagcgaccacagccccag
acactacagctggatttcctgatgaaaatcttgccaaactaccaccacttaaagaagaca
acgaaaggaagctcaactccagttaagaactaa

KEGG   Loxodonta africana (African savanna elephant): 100671785
Entry
100671785         CDS       T04351                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  dynactin 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100671785 (DCTN5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100671785 (DCTN5)
   05016 Huntington disease
    100671785 (DCTN5)
   05022 Pathways of neurodegeneration - multiple diseases
    100671785 (DCTN5)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100671785 (DCTN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671785 (DCTN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100671785 (DCTN5)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     100671785 (DCTN5)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     100671785 (DCTN5)
SSDB
Motif
Pfam: Hexapep Hexapep_2 DUF4954 Fucokinase
Other DBs
NCBI-GeneID: 100671785
NCBI-ProteinID: XP_003418867
UniProt: G3SMU5
LinkDB
Position
Unknown
AA seq 217 aa
MRPPRAEVEEQPEVAGNSVRQTLTRAGAAQRRWSAMELGELLYNKSEYIETASGNKVSRQ
SVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPL
HIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTV
FSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
NT seq 654 nt   +upstreamnt  +downstreamnt
atgagaccacctagagcggaagtggaggagcagccggaagtagccggaaactcagtcaga
cagactttgacaagggccggagctgcacagaggaggtggtcagccatggagctgggcgag
ctgctctacaacaagtctgagtacattgaaacggcatctgggaacaaagttagtcggcag
tcagtgctgtgtggaagccagaacattgtcctcaatggcaagaccatcgtgatgaatgac
tgtattatccgaggggatctggcaaacgtaagagttggacgccattgtgttgtgaaaagt
cgtagtgtcataaggccaccattcaagaaattcagcaaaggagttgctttctttccttta
catattggggaccatgtctttattgaggaagattgtgtggtcaacgcagctcagattggc
tcttatgttcatgttggaaagaactgtgtgattggacgccggtgtgttttgaaagactgt
tgcaaaattcttgacaacacagtattacccccagaaactgtggtcccaccattcaccgtc
ttctcaggctgcccaggactcttctcaggggagctcccagagtgtacccaggagctgatg
attgacgtcaccaagagctactaccagaagtttttgcccctgacacaagtctag

KEGG   Loxodonta africana (African savanna elephant): 100673543
Entry
100673543         CDS       T04351                                 

Gene name
DCTN4
Definition
(RefSeq) dynactin subunit 4
  KO
K10426  dynactin 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100673543 (DCTN4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100673543 (DCTN4)
   05016 Huntington disease
    100673543 (DCTN4)
   05022 Pathways of neurodegeneration - multiple diseases
    100673543 (DCTN4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673543 (DCTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100673543 (DCTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100673543 (DCTN4)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     100673543 (DCTN4)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     100673543 (DCTN4)
SSDB
Motif
Pfam: Dynactin_p62
Other DBs
NCBI-GeneID: 100673543
NCBI-ProteinID: XP_003404653
LinkDB
Position
Unknown
AA seq 460 aa
MASLLQSERVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENSHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
KYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPICASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLLECEKGDPDNINSTAKVMV
PPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggcgtccttgctgcaatcggagcgggttctctacctagtccagggagaaaagaaggtt
cgggccccgctgtcgcagctttacttctgtcggtattgtagcgagctgcggtcgctggaa
tgtgtgtctcacgaggtggattcccattattgtcccagttgcttagaaaacatgccatca
gccgaagccaaactgaaaaagaatagatgtgccaactgctttgactgtcctggctgcatg
cataccctctccacccgagcaacaagcatctccacacagctcccagatgaccccgctaag
accacaatgaagaaagcctattatctggcctgtggattttgtcgctggacatctagagat
gtgggcatggcagacaaatctgtggctagtggcggttggcaggaacctgaaaattctcat
acacaaaggatgaacaaactgattgaatattaccagcagcttgcccagaaagagaaagtt
gagcgagatcgcaagaaactggcacgacgtcgaaactatatgcctctggctttttcggac
aaatatggtcttggaaccaggcttcaacgaccacgagctggtgcatccatcagtaccctt
gccggactttcccttaaagaaggagaagaccaaaaagagataaagattgagccagctcag
gctgtagatgaagtggaacctctcccagaagactattatacaagaccagtaaatttaaca
gaggtgactactcttcagcagcgcctcttacagccagacttccaaccaatctgtgcttca
cagctctatcctcgccacaagcatcttctgataaaacggtccctacgctgccggaaatgt
gaacataatttgagcaagccagaatttaatccaacatctatcaaattcaaaatccaactg
gttgctgtcaattatatcccagaagtgagaatcatgtcaattcccaaccttcgctacatg
aaggagagccaggtactcctgactctaacaaatccagtggagaacctcacccatgtgact
ctgttggagtgcgagaagggtgaccctgataatatcaatagcactgctaaggtgatggtg
cctcccaaagagcttgttttagctggcaaggacgcagcagcagaatatgatgagttggca
gaaccccaggactttcaggatgaccctgacattatagccttcagaaaggccaacaaagtg
ggaattttcatcaaggttaccccacaacgtgaggagggcgaagtgaccgtgtgctttaag
atgaaacatgattttaaaaacctggcagcgcccatccgccccatcgaagaaagtgaccag
ggcacagaagtcatctggctcactcagcatgtggaactcagcttgggccctcttcttcct
taa

DBGET integrated database retrieval system