KEGG   Loxodonta africana (African savanna elephant): 100655149
Entry
100655149         CDS       T04351                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04530  Tight junction
lav04622  RIG-I-like receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100655149 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655149 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100655149 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100655149 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100655149 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100655149 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100655149 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655149 (MAP3K1)
   05161 Hepatitis B
    100655149 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655149 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100655149 (MAP3K1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100655149 (MAP3K1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100655149 (MAP3K1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100655149 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 100655149
NCBI-ProteinID: XP_023401234
LinkDB
Position
Unknown
AA seq 1454 aa
MAAAAGNRASSSGFPGAGAVSPEAGGGRGPLKASSVPAAAAGLLREAGSGGRERAEWRRR
QLRKVRSVELDRLPEPPIFLAASPPSSSTSPSPEPADSAAGGSDFQPLERREMESKETLK
GLHKMDDRPEERTIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEMNNLAPE
PQAEGQMSAASSAPKGRRSPSPGSSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAP
SPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGR
GTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKF
VSRMSNSHILSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCDDGCRNKLHHHC
MSIWAEECRRNREPLICPLCRSKWRSHDFYSHELPSPVDPPSSLRAAQQQTTQQQPLAGS
QRRTQESDSNLTHYGAQQVPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHD
VSGALLLANGESTGNSGGSGGSSPSVGAASGSSQTSISGDVVEACCNVLSMVCADPVYKV
YVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELC
KGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPA
EFYPHIVSTDVSQAEPVEVRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTV
PHVFSKLLEMLSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGIEDTLNGRHDSFLQASTN
SYPETTDDSSLERTVHLEKTGKGLCASSEDISDRLAGILVGLPSSTTTEQPKPMVQTKGR
PHSQCLNSSPLSHHSQLMFPALSTSSTPSSSAPSVPAGTVTDVSKQRPQGFIPCKIPSAS
PQTQRKFSLQFQRNCSESKDSDKLSPIFTQSRPLPSSNIHRPKPSRPTLGNISKQGDTSK
NSMTLDLNNSSKCDDSFGSSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEA
SMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSAS
QDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCY
QAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSN
YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLID
STGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCA
IIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPP
SRELLKHPVFRTTW
NT seq 4365 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggcggtg
agccccgaggcgggcggcggcagagggcccctgaaggcgagcagcgtgcccgcggcagcc
gcggggctcctgcgggaggcgggcagcgggggccgcgagcgggcggagtggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccggctgcccgagccgccgatcttcctc
gccgcctctccgccgtcctcctcaacttccccgtcgccggagcccgcggactcggcagcg
ggcgggagcgatttccagcctctagagcgtcgagagatggagagtaaggaaactctcaag
gggttgcacaagatggacgatcgcccagaagaacgaacgatcagggagaaactgaaggca
acctgtatgccagcctggaagcacgaatggctggaaaggagaaataggagaggccctgtg
gtggtaaaaccaatccctattaaaggagatggatctgaaatgaataacttagcacctgag
cctcaagcagagggccagatgagtgccgcttcatctgctcccaaaggccgacgcagccct
tctcctggcagctccccttcaggtcgcacagtgaaatcagagtctcccggagtaaggaga
aaaagagtttccccggttccttttcagagtgggagaatcacaccaccccgaagagcccct
tcgccagatggcttttcaccatacagccctgaagaaacaaaccgccgtgtaaacaaagtg
atgcgggccaggctatacctactacagcaaataggacccaactctttcctgatcggagga
gacagcccagacaataaataccgagtgtttattgggcctcagaactgcagctgtggacgt
ggaacattttgtattcatctgttatttgttatgcttcgggtgtttcaactagaaccttca
gatccaatgttgtggagaaaaacattaaagaattttgaggttgagagtttgttccagaag
tatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatccagaagttt
gtttcacgcatgtcaaattctcatatcttgtcatcatctagtacttctacatctagttca
gaaaacagtataaaagatgaagaggaacagatgtgtccgatctgcttgctgggcatgctt
gacgaagaaagtctcacagtgtgtgacgatggctgcaggaacaagctgcaccaccattgc
atgtcaatttgggcagaagaatgtagaagaaatagagaacctctaatatgtcccctctgt
aggtctaagtggagatcccatgatttctacagccacgagttaccaagtcctgtggatccc
ccctcttctctccgagctgcacagcagcagaccacacagcagcagcctttagctgggtca
caaaggaggactcaagagagcgattctaaccttactcactatggagctcagcaggtccct
cctgcttataaagacttagctgaaccatggattcaggtgtttggaatggaactcgttggc
tgcttattttctagaaactggaatgtaagagagatggccctccgacgtctttcccacgat
gttagcggggccctgctgttggcaaatggggagagcactggaaattccgggggcagtggt
ggaagcagcccaagtgttggagccgccagtgggtcttcccagaccagtatctcaggagac
gtggtagaggcatgctgcaacgttttgtcaatggtttgtgctgaccctgtctacaaagtg
tacgttgctgctttaaaaacgttaagagccatgctggtatatactccttgtcacagtttg
gcggaaagaatcaaacttcagagacttctccgaccagttgtagacaccattctagtcaag
tgtgcagatgccaatagccgcacaagtcagctgtccatatcaacactgttggaattatgc
aaaggccaagctggagagttggcagttggtagagaaatacttaaagctggatccattggt
attggtggtgttgattatgttttaaattgtattcttggaaaccaaactgaatcaaacaac
tggcaagaactcctgggccgcctttgtcttatagatagactattgttggaatttcctgct
gaattttaccctcatattgtcagtactgatgtttcacaagctgagcctgttgaagtcagg
tataagaagctgctgtccctcttaacctttgctttgcagtccattgataattctcactca
atggttggtaaactctcccgaaggatatatttgagttctgcaagaatggttactacagta
ccccatgtgttttcaaaactgttagagatgttgagcgtttccagttccactcactttacc
aggatgcgtcggcgtttgatggccattgcagatgaggtggagattgctgaggctatccag
ctgggcatagaagatactttgaatggtcggcatgacagctttttgcaggcgtctactaac
agctatccagaaaccacagacgacagttcccttgaacgcacagtccatttagaaaaaacc
ggaaagggattgtgtgccagttcagaggacatttctgacagactggccggcattttggta
ggacttcctagttcaacaacaacagagcaaccaaagccaatggttcaaacgaaaggcagg
ccccacagtcagtgtttgaactcctctcctttatctcatcattcccagttaatgttccca
gccttatcaacctcttcaaccccttcttcatctgccccatctgtaccagctggcactgta
acagatgtctctaagcaaagacctcagggattcattccctgtaaaataccttctgcatct
cctcaaacacagcgcaagttttctctacagttccagagaaactgttctgaaagcaaagac
tcagacaaactttcaccaatctttactcagtcaagacccctgccctccagtaatatacac
aggccaaagccatctcgacctaccctaggtaatataagtaaacagggagatacttcaaaa
aatagcatgacacttgatttgaacaattcttccaaatgtgatgacagctttggcagtagc
agcaatagtagtaatgctgttatacccagtgatgagacagtgttcaccccggtagaggag
aaatgcagattagatgtcaacacagagctcaactccagtattgaggaccttcttgaagca
tccatgccttcaagtgacacaacagtaacttttaagtcagaagttgctgtcctctcgcct
gaaaaagctgaaaatgatgatacctacaaagatgatgtgaatcataatcagaaatgcaaa
gaaaagatggaagctgaagaagaagaagctttagcgattgccatggcgatgtcagcgtct
caggatgccctccccatagttcctcaactgcaggttgaaaatggagaagatatcatcatt
attcaacaggatacaccagagactctaccaggacataccaaagcaaaacaaccttataga
gaagatacggagtggctgaaaggccagcagattggccttggagcattttcttcttgttat
caggctcaagatgtgggaactggaactttaatggctgtcaaacaggtgacatatgtcaga
aacacatcttctgaacaagaggaagtggtggaagcattaagagaagagataagaatgatg
agccatctgaatcaccccaacatcattaggatgttaggagccacatgtgagaagagcaat
tacaatctcttcatcgaatggatggcaggcggatctgtggctcatttgctgagtaaatat
ggagccttcaaggaatcggtagttattaactatactgaacaattacttcgcggcctttcg
tatctccatgaaaaccagatcattcacagagatgtcaaaggtgccaatctgctaattgac
agcacaggtcagaggctgagaattgcggattttggagctgcagccaggttggcatcaaaa
gggactggtgcaggggagtttcagggacagttactggggacgattgcatttatggcacct
gaggttctgagaggtcagcagtatggtaggagctgtgatgtgtggagtgttggctgtgct
attatagaaatggcttgtgctaaaccaccttggaatgcagaaaaacactctaatcatctg
gccttgatatttaagattgctagtgcaactactgctccatcgatcccttctcatctgtct
cctggtttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctcca
tcaagagagctactgaagcatccagtcttccgtactacgtggtag

DBGET integrated database retrieval system