KEGG   Loxodonta africana (African savanna elephant): 100655149
Entry
100655149         CDS       T04351                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04120  Ubiquitin mediated proteolysis
lav04530  Tight junction
lav04622  RIG-I-like receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100655149 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655149 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100655149 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100655149 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100655149 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    100655149 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100655149 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655149 (MAP3K1)
   05161 Hepatitis B
    100655149 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655149 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100655149 (MAP3K1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100655149 (MAP3K1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100655149 (MAP3K1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100655149 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 100655149
NCBI-ProteinID: XP_023401234
LinkDB
Position
Unknown
AA seq 1454 aa
MAAAAGNRASSSGFPGAGAVSPEAGGGRGPLKASSVPAAAAGLLREAGSGGRERAEWRRR
QLRKVRSVELDRLPEPPIFLAASPPSSSTSPSPEPADSAAGGSDFQPLERREMESKETLK
GLHKMDDRPEERTIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEMNNLAPE
PQAEGQMSAASSAPKGRRSPSPGSSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAP
SPDGFSPYSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGR
GTFCIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKF
VSRMSNSHILSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCDDGCRNKLHHHC
MSIWAEECRRNREPLICPLCRSKWRSHDFYSHELPSPVDPPSSLRAAQQQTTQQQPLAGS
QRRTQESDSNLTHYGAQQVPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHD
VSGALLLANGESTGNSGGSGGSSPSVGAASGSSQTSISGDVVEACCNVLSMVCADPVYKV
YVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCADANSRTSQLSISTLLELC
KGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPA
EFYPHIVSTDVSQAEPVEVRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTV
PHVFSKLLEMLSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGIEDTLNGRHDSFLQASTN
SYPETTDDSSLERTVHLEKTGKGLCASSEDISDRLAGILVGLPSSTTTEQPKPMVQTKGR
PHSQCLNSSPLSHHSQLMFPALSTSSTPSSSAPSVPAGTVTDVSKQRPQGFIPCKIPSAS
PQTQRKFSLQFQRNCSESKDSDKLSPIFTQSRPLPSSNIHRPKPSRPTLGNISKQGDTSK
NSMTLDLNNSSKCDDSFGSSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEA
SMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSAS
QDALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCY
QAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSN
YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLID
STGQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCA
IIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPP
SRELLKHPVFRTTW
NT seq 4365 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggcggtg
agccccgaggcgggcggcggcagagggcccctgaaggcgagcagcgtgcccgcggcagcc
gcggggctcctgcgggaggcgggcagcgggggccgcgagcgggcggagtggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccggctgcccgagccgccgatcttcctc
gccgcctctccgccgtcctcctcaacttccccgtcgccggagcccgcggactcggcagcg
ggcgggagcgatttccagcctctagagcgtcgagagatggagagtaaggaaactctcaag
gggttgcacaagatggacgatcgcccagaagaacgaacgatcagggagaaactgaaggca
acctgtatgccagcctggaagcacgaatggctggaaaggagaaataggagaggccctgtg
gtggtaaaaccaatccctattaaaggagatggatctgaaatgaataacttagcacctgag
cctcaagcagagggccagatgagtgccgcttcatctgctcccaaaggccgacgcagccct
tctcctggcagctccccttcaggtcgcacagtgaaatcagagtctcccggagtaaggaga
aaaagagtttccccggttccttttcagagtgggagaatcacaccaccccgaagagcccct
tcgccagatggcttttcaccatacagccctgaagaaacaaaccgccgtgtaaacaaagtg
atgcgggccaggctatacctactacagcaaataggacccaactctttcctgatcggagga
gacagcccagacaataaataccgagtgtttattgggcctcagaactgcagctgtggacgt
ggaacattttgtattcatctgttatttgttatgcttcgggtgtttcaactagaaccttca
gatccaatgttgtggagaaaaacattaaagaattttgaggttgagagtttgttccagaag
tatcacagtaggcgtagctcaaggatcaaagctccatctcgtaacaccatccagaagttt
gtttcacgcatgtcaaattctcatatcttgtcatcatctagtacttctacatctagttca
gaaaacagtataaaagatgaagaggaacagatgtgtccgatctgcttgctgggcatgctt
gacgaagaaagtctcacagtgtgtgacgatggctgcaggaacaagctgcaccaccattgc
atgtcaatttgggcagaagaatgtagaagaaatagagaacctctaatatgtcccctctgt
aggtctaagtggagatcccatgatttctacagccacgagttaccaagtcctgtggatccc
ccctcttctctccgagctgcacagcagcagaccacacagcagcagcctttagctgggtca
caaaggaggactcaagagagcgattctaaccttactcactatggagctcagcaggtccct
cctgcttataaagacttagctgaaccatggattcaggtgtttggaatggaactcgttggc
tgcttattttctagaaactggaatgtaagagagatggccctccgacgtctttcccacgat
gttagcggggccctgctgttggcaaatggggagagcactggaaattccgggggcagtggt
ggaagcagcccaagtgttggagccgccagtgggtcttcccagaccagtatctcaggagac
gtggtagaggcatgctgcaacgttttgtcaatggtttgtgctgaccctgtctacaaagtg
tacgttgctgctttaaaaacgttaagagccatgctggtatatactccttgtcacagtttg
gcggaaagaatcaaacttcagagacttctccgaccagttgtagacaccattctagtcaag
tgtgcagatgccaatagccgcacaagtcagctgtccatatcaacactgttggaattatgc
aaaggccaagctggagagttggcagttggtagagaaatacttaaagctggatccattggt
attggtggtgttgattatgttttaaattgtattcttggaaaccaaactgaatcaaacaac
tggcaagaactcctgggccgcctttgtcttatagatagactattgttggaatttcctgct
gaattttaccctcatattgtcagtactgatgtttcacaagctgagcctgttgaagtcagg
tataagaagctgctgtccctcttaacctttgctttgcagtccattgataattctcactca
atggttggtaaactctcccgaaggatatatttgagttctgcaagaatggttactacagta
ccccatgtgttttcaaaactgttagagatgttgagcgtttccagttccactcactttacc
aggatgcgtcggcgtttgatggccattgcagatgaggtggagattgctgaggctatccag
ctgggcatagaagatactttgaatggtcggcatgacagctttttgcaggcgtctactaac
agctatccagaaaccacagacgacagttcccttgaacgcacagtccatttagaaaaaacc
ggaaagggattgtgtgccagttcagaggacatttctgacagactggccggcattttggta
ggacttcctagttcaacaacaacagagcaaccaaagccaatggttcaaacgaaaggcagg
ccccacagtcagtgtttgaactcctctcctttatctcatcattcccagttaatgttccca
gccttatcaacctcttcaaccccttcttcatctgccccatctgtaccagctggcactgta
acagatgtctctaagcaaagacctcagggattcattccctgtaaaataccttctgcatct
cctcaaacacagcgcaagttttctctacagttccagagaaactgttctgaaagcaaagac
tcagacaaactttcaccaatctttactcagtcaagacccctgccctccagtaatatacac
aggccaaagccatctcgacctaccctaggtaatataagtaaacagggagatacttcaaaa
aatagcatgacacttgatttgaacaattcttccaaatgtgatgacagctttggcagtagc
agcaatagtagtaatgctgttatacccagtgatgagacagtgttcaccccggtagaggag
aaatgcagattagatgtcaacacagagctcaactccagtattgaggaccttcttgaagca
tccatgccttcaagtgacacaacagtaacttttaagtcagaagttgctgtcctctcgcct
gaaaaagctgaaaatgatgatacctacaaagatgatgtgaatcataatcagaaatgcaaa
gaaaagatggaagctgaagaagaagaagctttagcgattgccatggcgatgtcagcgtct
caggatgccctccccatagttcctcaactgcaggttgaaaatggagaagatatcatcatt
attcaacaggatacaccagagactctaccaggacataccaaagcaaaacaaccttataga
gaagatacggagtggctgaaaggccagcagattggccttggagcattttcttcttgttat
caggctcaagatgtgggaactggaactttaatggctgtcaaacaggtgacatatgtcaga
aacacatcttctgaacaagaggaagtggtggaagcattaagagaagagataagaatgatg
agccatctgaatcaccccaacatcattaggatgttaggagccacatgtgagaagagcaat
tacaatctcttcatcgaatggatggcaggcggatctgtggctcatttgctgagtaaatat
ggagccttcaaggaatcggtagttattaactatactgaacaattacttcgcggcctttcg
tatctccatgaaaaccagatcattcacagagatgtcaaaggtgccaatctgctaattgac
agcacaggtcagaggctgagaattgcggattttggagctgcagccaggttggcatcaaaa
gggactggtgcaggggagtttcagggacagttactggggacgattgcatttatggcacct
gaggttctgagaggtcagcagtatggtaggagctgtgatgtgtggagtgttggctgtgct
attatagaaatggcttgtgctaaaccaccttggaatgcagaaaaacactctaatcatctg
gccttgatatttaagattgctagtgcaactactgctccatcgatcccttctcatctgtct
cctggtttacgagatgtggctcttcgttgtttagaacttcaacctcaggacagacctcca
tcaagagagctactgaagcatccagtcttccgtactacgtggtag

KEGG   Loxodonta africana (African savanna elephant): 100662122
Entry
100662122         CDS       T04351                                 

Gene name
MAP3K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3 isoform X1
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav05166  Human T-cell leukemia virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100662122 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100662122 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100662122 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100662122 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100662122 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100662122 (MAP3K3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100662122 (MAP3K3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100662122 (MAP3K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 100662122
NCBI-ProteinID: XP_010592858
LinkDB
Position
Unknown
AA seq 657 aa
MDEQEALDSIMKDLVALQMTRRTRLPGYETMKNKDTGHPNRQKKHNSSSPALLNSPTVTT
GSCAGASEKKKFLSDVRIKFEHNGERRIIPFSRPVRYEDVEHKVATVFGQPLELHYMNNE
LSILLKNQDDLDKAIDILDRSSSMKSLRILLLSRDRNHTSSSPHSGVSRQVRIKASQSAG
DINTIYQPSEPRSRHLSVGSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETS
EQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKG
VKGGTYPRRYHVSVHHKDYNDGRRTFPRIRRHQGNLFTLVPSIRSLSTNGENLGLAVQYL
DPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELA
SKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGG
SVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFG
ASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE
YEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLGY
NT seq 1974 nt   +upstreamnt  +downstreamnt
atggatgaacaagaagcattggactcgatcatgaaggatctggtggccctccagatgacc
cgacgtacccggctgcctggatatgagaccatgaagaacaaggacacgggtcacccaaat
aggcagaaaaaacacaacagcagcagcccagcccttctgaacagccccacagtaacaaca
ggctcatgtgcaggggccagtgagaaaaagaaatttttgagtgacgtcagaatcaagttt
gagcacaacggggagaggcgaattataccattcagccggcccgtgagatacgaagatgtg
gagcacaaggtggcaacggtatttgggcagcctcttgagctacattacatgaacaatgag
ctctccatcctgctgaaaaaccaagatgatcttgataaggcaattgacattttggataga
agctcaagcatgaaaagccttaggatattgctgctgtcccgggacagaaaccataccagt
tcctctccccactctggggtgtccaggcaggtgcggatcaaggcttctcagtctgcaggg
gatataaatactatctaccagccctctgagcccagaagcaggcacctctctgttggctcc
cagaaccctggccgaagctcgcctccccctggctatgtgcctgagcggcagcagcacatt
gcccggcaggggtcctacaccagcatcaacagtgagggggagttcatcccagagaccagc
gagcagtgcatgctggatcctctgagcagtgctgaaaactccttgtcgggaagctgccaa
tccttggacaggtcagcagacagcccatccttccgtaaatcacgaatgtcccgagcccag
agcttcccagacaacagacaggaatactcggatcgggaaactcagctctacgacaaagga
gtcaaaggtggaacctacccccggcgctaccatgtgtctgtgcaccacaaggactacaac
gatggcagaagaacatttccaagaatacggcgccatcaaggcaacttgttcaccctggtg
ccctccatccgctccctgagcacaaacggcgagaacctggggctggctgtgcagtacttg
gacccccgtgggcgcctgcggagtgcagatagcgagaacgccctctctgtgcaggagagg
aatgtgccaaccaagtctcctagcgcccccattaattggcgccgggggaagctcctgggc
cagggtgccttcggccgggtgtatttgtgctatgatgtcgacacaggacgtgaacttgcc
tccaagcaggtccagtttgacccagacagtcctgagacaagcaaggaggtgagtgccctg
gagtgcgagatccagctgctgaagaacctacagcatgagcgcatcgtgcagtactacggc
tgtctgcgggaccgcgctgagaagacgctgaccatcttcatggagtacatgcctgggggc
tcagtgaaagaccagttgaaggcctatggagctctgacagagagtgtgactcgcaagtac
acccggcagatcctggagggcatgtcctacctgcacagcaacatgattgttcaccgggac
atcaagggagccaacatcctccgagactccgctgggaacgtgaagctgggggactttggg
gccagcaagcgcctgcaaaccatctgcatgtcggggacgggcatgcgctcagtcaccggc
actccatactggatgagccctgaggtgatcagcggtgagggctacggaaggaaggcagac
gtgtggagcctgggctgcactgtggtggaaatgctgacagagaagccaccttgggcagag
tatgaagccatggctgccatcttcaagattgccacccagcctaccaaccctcagctgccc
tcccacatctctgaacacgggcgggacttcctgaggcgcattttcgtggaggcccgccag
agaccttcggctgaggagctgctcacacaccattttgcacagctcgggtactga

KEGG   Loxodonta africana (African savanna elephant): 100664871
Entry
100664871         CDS       T04351                                 

Gene name
MAP3K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664871 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100664871 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100664871 (MAP3K4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100664871 (MAP3K4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100664871 (MAP3K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal RIO1 DUF2963
Other DBs
NCBI-GeneID: 100664871
NCBI-ProteinID: XP_023415145
LinkDB
Position
Unknown
AA seq 1627 aa
MEEPPPPPLPPPEPEPESEPERCLAARQEYESGDTGCKNSESDLEDFSDEINAENLYGTS
PPSTPRQMKRMSAKHQRNNAGRPASRANLKEKMNAPNQSPHKDTGKTVENVEEYSYKQEK
KIRATLRTTERDHKKNVQCSFMLDSVGGSLPKKSIPDVDLHKPYLSLGCSNAKLPVSMPM
PIARTARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQRGQENTAFWFNRSNELIW
LELQAWHAGRTINDQDLFLYTARQAIPDIINEILTFKVNYGSFASVRNGASFNGTSLEGQ
CNAPHETKTVGYSTYHEHLQRQRVSFEQVKRIMELLEYIEALYPSLQALQKDYEKYAAKD
FQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLSDIGWPVFEIPSPRPSKGNEAEDEGD
DPEGDLEELESSADESEGEHTPGRTGQEIRQPPENSVDIQPQDCVPKKLERLESEEDSAG
WGAPDGSTEVGFSRHCRTSIYRPFVDKALKQMGLRKLILRLHKLMDGSLQRARIALVKSD
HPMEFSEFPDPMWGSDYVQLSSTPPSSEQKCSAVSWEELNSMDLPSFEPAFSVLCRVLLN
VIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLHELLDGLEQTDR
NMDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEA
QAGKLFCDIAGMLLKSTGSFLGSGLQESCADDSSAAEEIRRSVIEISRALKELFHEARER
ASKALGFAKMLRKDLEIAAEFMLSAPVRDLLDVLKSKQYVKIQIPGLENLQVFVPDSLAE
EKSIILQLLNAAAGKDCSKDSEDIVIDAHLLLTKRSDPDQGSDDGWGTWQEPPVKVVPQA
ETVDTLRNVQVDNVLLVVMQSGHLTIQRKAFQQSIDGLMTLRQEQTSSQPVIAKALQQLK
NDALELCNRISDAIDQVDRMFISEFDAEVDESESVTLQQYYREAMIQGYNFGFEYHKEVV
RLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFISALP
EDDFLNLQALMNECIGHVIGKPHSPVTALHRNSPRPVKVPRCHSDPPNPHLIIPTPEGFS
TRSVPSDARSHGSPAAAATATATAGRPSPSGSDSAPPKLTSSAPETRGSSVPENDRLASI
AAELQFRSLSRHSSPTEERDEPAYPKGDSSASARRSWELRTLISQTKDTASKQGPIEAIQ
KSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVY
TCISVDTGELMAMKEVSQPLIDLIVTFGTNEFAVQVLVAPGWFGAIHTEWSRLKPIAVES
ISTHSDPIGQSRTALCNLSVMVRACASRGSFSLRIHPREALSTGPCFIPPQEEMYIFMEY
CDEGTLEEVSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGD
FGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTG
KRPWHEYEHNFQIMYKVGMGHKPPIPEKLSPEGKDFLSHCLESDPKMRWTASQLLDHSFV
KVCTDEE
NT seq 4884 nt   +upstreamnt  +downstreamnt
atggaggagccgccgccgccaccgctgccgccgccggaaccggagcctgaatccgaacct
gagcgctgcctggcggcgaggcaagaatacgagtcgggagacacaggttgtaagaattct
gaatctgacctagaggatttttcagatgaaataaatgcagaaaatctgtatggcacctct
ccccccagcacacctcggcagatgaaacggatgtcagccaaacaccagaggaataatgct
gggaggcctgccagcagggcaaatttgaaagaaaaaatgaatgcaccaaatcagtctcca
cacaaagacactggaaaaacagtggagaacgtcgaagaatacagctataagcaggagaaa
aagatccgagcaactcttcgaacaacagagcgtgatcataaaaaaaacgtacagtgctcg
ttcatgttagactcagtgggtgggtcattgccgaaaaaatcaattccagatgtggatctc
cataagccttacctcagcctcggctgcagcaatgctaagctcccggtgtctatgcccatg
cctatagccagaactgcacgccagacctctaggaccgactgtccagcagatagattaaag
ttttttgaaacattacgacttcttctaaagcttacctcagtctcaaagaagaaggacagg
gagcaaagaggacaagaaaatactgctttctggtttaaccgatctaacgaactgatctgg
ctggagctccaagcctggcatgcagggcggaccattaatgaccaggacctctttttatac
acagcccgtcaagccatccctgacatcatcaatgaaatccttactttcaaagttaactat
gggagctttgcctctgttagaaatggagctagttttaatggtacttcactagaagggcag
tgcaatgccccccatgaaacaaagactgtgggttactcaacgtatcacgagcatctccaa
cgccagagggtctcatttgagcaggtaaagcggataatggagctgctagagtacatagag
gcactttatccatcgttgcaggcccttcaaaaggactacgagaaatatgctgcaaaggac
ttccaggacagggtgcaggcactctgtttgtggttaaacatcacaaaagacttaaatcag
aaattaaggattatgggcaccgttttgggcatcaagaatttgtcagacattggctggcca
gtgtttgaaatcccttctcctcgaccatccaaaggcaatgaagcagaggatgagggagat
gacccagaaggagacttggaagagctggaaagcagtgcagatgagagtgaaggagaacac
acccctggtcggacggggcaggagatcagacagcccccagagaacagtgtcgacatccag
ccccaggactgtgtgccaaagaagcttgaacggctcgagtctgaagaggactcagctggt
tggggagccccagacggcagtacggaagtgggcttcagcagacactgtcggacttctatc
tatagaccgtttgtagacaaagccctgaagcagatgggcttacgaaagttaattctaaga
cttcacaagctgatggacggctccttgcaaagggcgcggatagcgttggtaaagagcgat
catcccatggagttttcagagtttccggatcccatgtggggctcggattacgtgcagttg
tccagcacacccccttcctctgagcagaagtgcagcgccgtctcctgggaggagctgaac
tccatggacttgccctcattcgaacctgccttctcagtcctctgccgtgtcctcctcaat
gtgatacatgagtgtctgaagttacgactggagcagcggcctgccggagagccatccctc
ctgagcattaagcagctggtgagggagtgtaaggaggtcctgaagggcggccttctgatg
aagcagtactaccagttcatgctgcacgagctcctggacggcctggagcagacagaccgc
aacatggatgccttcgaggaggatctgcataaaatgctgatggtatattttgattacatg
agaagctggatccaaatgctacagcagttacctcaagcttcccatagtttaaaaaatctg
ttagaagaagaatggaatttcaccaaagaaataactcattacatacggggaggagaagca
caggccgggaagcttttctgtgacattgcaggaatgctgttgaagtcaacaggcagcttt
ttgggatctggcttacaggagagctgtgctgacgacagcagtgctgcagaggaaatcagg
cgatctgtcatagagattagccgagccctgaaggaactcttccacgaagccagagaaagg
gcctccaaggcgcttggatttgctaaaatgttaagaaaggacctggaaatagcagcagaa
ttcatgctttcggcccctgttagagacctgctggatgttctgaaatcaaagcagtatgtt
aagatacaaatccctgggctagaaaacttgcaggtatttgttccagacagtcttgctgag
gagaagagcattatcttgcagttactcaatgcagctgcaggaaaggactgttccaaagac
tcagaggacatagtgattgacgcccatctgctgctgaccaagcgcagcgatcctgaccag
ggctcagatgatggctggggcacgtggcaagaaccgcctgtgaaagttgtgcctcaggcg
gagactgttgatacactgaggaatgtgcaggtggataatgtcttactagttgtcatgcag
tctggccatctgacgatccagaggaaagccttccagcagtccatcgacggactcatgact
ctccgccaggagcagacgtccagccaaccagtcattgccaaagctttgcagcagctgaag
aatgatgcattggagctatgcaacagaataagtgatgccattgaccaagtggaccgcatg
ttcatatccgagtttgatgccgaagtcgacgagtctgagtctgtcacgttgcagcagtac
taccgggaagcaatgattcaggggtacaactttggctttgagtatcataaagaagttgtt
cgcttgatgtctggagagtttagacagaagataggagacaaatatataagctttgcccgg
aaatggatgaattacgtcctgactaaatgtgagagtggtcgaggtacaagacccaggtgg
gcaactcaaggatttgattttctacaagccattgaacctgcctttatttcagctttacca
gaagatgactttttgaatctacaagccttgatgaacgaatgcattggccatgtcatagga
aagccgcacagtcctgttacagctctccatcggaacagtccccgtcctgtgaaggtgcct
cgatgccacagtgaccctcctaacccccacctcattatccccactccagaggggttcagc
actcggagcgtgccttcggatgcgcggagccacggcagccctgctgctgctgctactgct
accgccaccgccgggcgccccagcccctctggcagcgactctgcgccacccaaactcacc
agcagtgcccctgagaccaggggttccagcgtcccagagaacgatcgactggcctccata
gctgctgagctgcagttcaggtccctgagtcggcactccagccccaccgaggagcgtgat
gaacccgcatatccgaaaggtgattcaagtgcatcagcgcgaagaagctgggagctgcgg
accctcatcagccagacgaaggatactgcttctaagcaaggacccattgaagctattcag
aagtcagttcgattgtttgaagaaaagcggtatcgagaaatgaggagaaagaatatcatt
ggtcaagtttgtgacacccccaagtcctatgataacgtcatgcatgttggcttgaggaag
gtcaccttcaaatggcagagaggaaacaaaattggggaagggcagtacgggaaggtctat
acttgcatcagcgttgacactggtgaactgatggctatgaaggaggtaagtcagcctctg
atagacttgatagtgacgtttgggactaatgagtttgcggttcaagttcttgttgcacca
ggctggtttggagctatccatacggagtggtccaggcttaaacccattgctgtcgagtcg
atttcgactcatagcgaccctataggacagagtagaactgccttatgtaacttgagcgtc
atggtccgagcatgcgcttccaggggaagtttttctcttcgcatacacccaagggaagcg
ttaagcacagggccgtgttttattcctccgcaggaagaaatgtacatctttatggagtac
tgtgacgagggcacgctggaggaggtgtcacggctgggccttcaggaacacgtcatcagg
ctgtactcaaagcagatcaccatcgcaatcaacgttctccacgagcatggcatagttcat
cgtgacatcaaaggtgccaatatcttccttacctcatctggactcatcaaactgggagat
ttcgggtgctcagtgaagctcaagaacaacgcacagaccatgcctggcgaagtgaatagc
acactggggacagcagcttacatggctcccgaagtcatcacccgagctaaaggggaagga
cacggacgtgctgctgatatctggagtctgggctgtgtcgtcatagaaatggtcaccggg
aagaggccttggcatgagtatgaacacaactttcaaattatgtataaagtgggaatggga
cataagccaccaatccctgaaaaattaagccctgaaggaaaggacttcctttctcactgc
cttgaaagtgacccaaagatgagatggacggccagccagctcctcgaccactcgtttgtc
aaggtttgcacagatgaagaatga

KEGG   Loxodonta africana (African savanna elephant): 100665139
Entry
100665139         CDS       T04351                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04540  Gap junction
lav04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665139 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100665139 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100665139 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665139 (MAP3K2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100665139 (MAP3K2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE11 family
   100665139 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 100665139
NCBI-ProteinID: XP_003416734
LinkDB
Position
Unknown
AA seq 620 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKTKSLSPKKQNDVRVKFEHRGEKRILQF
SRPVKLEDLRSKAKVAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILL
VVNGSTQATNLEPLPSLEDLDNTVFGAERKKRLSVIGSTSRDRSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGENYPKSRMPRAQS
YPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHQQEYNDGRKTFPRARRNQGTSFRSPV
SFSPTDHSLSTSSGSSIFTPECDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLG
KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIV
QYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMI
VHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYG
RKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFV
EAKLRPSADELLRHMFVHYH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgatggatgatcaacaagctttgaactcaatcatgcaagatttggctgtccttcataag
gccagtcgaccagcattatccttacaggaaaccagaaaaacaaagtctttgtcaccaaaa
aaacagaatgatgttcgagtcaaatttgaacatagaggagaaaaaagaattcttcagttc
tccaggccagttaaactggaagatctgaggtctaaagctaaagtcgcctttggacagtct
atggatctacattataccaacaatgagttggtaattccactgactactcaagatgacctg
gacaaagctgtggaattgctagatcgtagcattcacatgaagagcctcaagatactactt
gtagtaaatggaagtacacaggctactaatttagaaccattaccatcactagaagacttg
gataacacagtatttggagcagaaaggaaaaaacggctttctgtgataggttctactagt
agagatagaagctcccctcccccgggatacattccagatgaattacatcaggttgctcgg
aatgggtcattcactagtatcaacagtgaaggagagttcattccagaaagcatggaccaa
atgctggatccattatctttaagcagccctgaaaattctggctcaggaagctgtccatca
cttgatagtcctttggatggagagaactatccaaaatcacgaatgcccagggcacagagc
tacccagataaccatcaagaattttcagactatgataaccctatctttgagaaatttgga
aaaggaggaacatatccaagaaggtatcatgtttcctatcaccagcaagagtataacgat
ggtcgtaaaacttttcccagagctagaaggaaccaggggaccagcttccggtctcctgtg
agttttagtcccactgaccattccttaagcactagtagtggaagcagtatcttcacccca
gagtgtgacgacagtcggataagaagaaggggaagtgacatagacaaccctactctgact
gtaatggacatcagcccacccagccggtcacctcgtgctccaaccaactggagattgggc
aaactgctgggccagggagcctttggcagggtctacctctgttacgacgtcgatacagga
agagaattggctgttaaacaagttcaatttgaccctgatagccctgagaccagcaaggaa
gtgaatgcacttgagtgtgaaattcagttgttgaaaaacttgctgcatgaacgaattgtt
cagtattatggctgtctgagggatccccaggaaaaaacactttccatatttatggaatat
atgccagggggttcaattaaggaccaactaaaagcatacggggctcttactgagaacgtg
accaggaagtacacccgccagattctggagggtgtccattatttgcacagtaacatgatt
gtccatagagatatcaaaggtgcaaatattttgcgagactcaacaggcaatgtcaaacta
ggagattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaag
tcagtcacaggcacaccatactggatgagccctgaagtgatcagtggagaaggctatggc
agaaaagcagatatctggagtgtagcctgcactgtggtggaaatgctaacggaaaagccc
ccttgggctgagtttgaagcaatggctgccatctttaaaatcgctacccagccgacaaac
ccaaagctgccaccccacgtctcagactatactcgggatttcctcaaacggatttttgtg
gaggccaaactgagaccctcagctgacgagctcttgaggcacatgtttgtgcattatcac
tag

DBGET integrated database retrieval system