KEGG   Loxodonta africana (African savanna elephant): 100655161
Entry
100655161         CDS       T04351                                 

Gene name
GATA3
Definition
(RefSeq) LOW QUALITY PROTEIN: trans-acting T-cell-specific transcription factor GATA-3
  KO
K17895  GATA-binding protein 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04928  Parathyroid hormone synthesis, secretion and action
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100655161 (GATA3)
   04659 Th17 cell differentiation
    100655161 (GATA3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100655161 (GATA3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100655161 (GATA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655161 (GATA3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    100655161 (GATA3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon ArfGap DZR_2 Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 100655161
NCBI-ProteinID: XP_003410636
LinkDB
Position
Unknown
AA seq 444 aa
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGSKALGSHHSASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECIKYQVSLPDSMKLESSHSRGSMTTLGGAFLLSHHPITTYPXYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDTLEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtgacagcggaccagccgcgctgggtgagccaccaccaccccgcagtgctcaac
gggcagcacccggacacgcaccacccgggcctcggccactcctacatggacccggctcag
taccctttgcccgaggaggtggatgtactttttaacatcgacggccaaggcaaccacgtc
ccgtcctactacggaaactcggtgagggccactgtgcagaggtaccctccgacccaccac
gggagccaggtatgccgccctccactgctgcacggatccctgccctggctggatggtagc
aaagccctgggcagccaccacagcgcttcgccctggaacctcagcccgttctccaagaca
tccatccaccacggctccccggggcccctctcagtctatcccccggcctcatcctcctcc
ctgtcggcgggccattccagcccgcacctcttcaccttcccgcccaccccgccaaaggac
gtctccccggacccgtccttgtccacaccgggctcagccggctctgcccggcaggatgag
aaagagtgcattaagtaccaggtgtccctgccagacagcatgaagctcgagtcatcgcac
tcccgtggcagcatgactactctgggaggggctttcctcctcagccaccaccccatcact
acctacccancctacgtccccgaatacagctccggactcttccctcccagcagccttctg
ggaggctcacctaccgggtttggatgcaagtcgaggcccaaggcgagatccagcacagaa
ggcagggagtgtgtaaactgcggggcgacctcaactccactgtggcggagagatgggacg
gggcactacctttgcaatgcctgcgggctctaccacaaaatgaatggacagaaccgaccc
ctcattaagcccaagagaaggctgtcggcagcaagaagagcaggtacatcctgtgcaaac
tgtcagactaccactaccactctctggaggagaaatgccaatggagaccctgtctgcaac
gcctgtgggctctactacaagctgcacaatattaacagacccttgactatgaagaaggaa
ggaatccagaccagaaaccgaaaaatgtctagcaaatccaaaaagtgcaaaaaggtgcat
gacacgctggaggacttccccaagagcagctcgtttaacccagccgccctctccagacac
atgtcttccctcagccacatttcacctttcagccactccagccacatgctgaccactcca
acaccgatgcacccaccgtccagcctctcctttggacctcaccatccttccagtatggtc
accgccatgggttag

DBGET integrated database retrieval system