KEGG   Loxodonta africana (African savanna elephant): 100655206
Entry
100655206         CDS       T04351                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
lav05142  Chagas disease
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100655206
   04020 Calcium signaling pathway
    100655206
   04072 Phospholipase D signaling pathway
    100655206
   04024 cAMP signaling pathway
    100655206
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100655206
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100655206
  09152 Endocrine system
   04911 Insulin secretion
    100655206
   04922 Glucagon signaling pathway
    100655206
   04923 Regulation of lipolysis in adipocytes
    100655206
   04912 GnRH signaling pathway
    100655206
   04913 Ovarian steroidogenesis
    100655206
   04915 Estrogen signaling pathway
    100655206
   04921 Oxytocin signaling pathway
    100655206
   04926 Relaxin signaling pathway
    100655206
   04935 Growth hormone synthesis, secretion and action
    100655206
   04918 Thyroid hormone synthesis
    100655206
   04928 Parathyroid hormone synthesis, secretion and action
    100655206
   04916 Melanogenesis
    100655206
   04924 Renin secretion
    100655206
   04925 Aldosterone synthesis and secretion
    100655206
   04927 Cortisol synthesis and secretion
    100655206
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100655206
   04270 Vascular smooth muscle contraction
    100655206
  09154 Digestive system
   04970 Salivary secretion
    100655206
   04971 Gastric acid secretion
    100655206
   04972 Pancreatic secretion
    100655206
   04976 Bile secretion
    100655206
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100655206
   04961 Endocrine and other factor-regulated calcium reabsorption
    100655206
  09156 Nervous system
   04724 Glutamatergic synapse
    100655206
   04728 Dopaminergic synapse
    100655206
   04726 Serotonergic synapse
    100655206
   04730 Long-term depression
    100655206
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100655206
  09159 Environmental adaptation
   04713 Circadian entrainment
    100655206
   04714 Thermogenesis
    100655206
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655206
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100655206
  09165 Substance dependence
   05030 Cocaine addiction
    100655206
   05031 Amphetamine addiction
    100655206
   05032 Morphine addiction
    100655206
   05034 Alcoholism
    100655206
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100655206
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100655206
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100655206
   05165 Human papillomavirus infection
    100655206
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100655206
   05142 Chagas disease
    100655206
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100655206
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100655206
   04031 GTP-binding proteins [BR:lav04031]
    100655206
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100655206
  Exosomal proteins of other body fluids (saliva and urine)
   100655206
  Exosomal proteins of colorectal cancer cells
   100655206
  Exosomal proteins of bladder cancer cells
   100655206
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100655206
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU
Other DBs
NCBI-GeneID: 100655206
NCBI-ProteinID: XP_010597766
LinkDB
Position
Unknown
AA seq 362 aa
MEDAPQILLVFFDPGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKV
QDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKA
LWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKF
QVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNL
FKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDP
RVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYE
LL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggaggacgcgccccagattctccttgttttctttgatccaggtgctggagaatctggt
aaaagcaccattgtgaagcagatgaggatcctgcatgttaatgggtttaatggagagggc
ggcgaagaggacccgcaggctgcaaggagcaacagcgatggtgagaaggcaacgaaggtg
caggacatcaaaaacaacctgaaggaggccattgaaaccattgtggccgccatgagcaac
ctggtcccccctgtggagctggccaaccctgagaaccagttcagagtggactacattctg
agcgtgatgaacgtgccagacttcgatttccctcctgaattctacgagcatgccaaagct
ctctgggaggatgaaggggtgcgtgcctgctatgagcgctccaacgagtaccagctcatc
gactgcgcccagtacttcctggacaagatcgatgtcatcaagcaggccgactacgtgcca
agtgaccaggatctgctccgctgccgtgtcctgacttctggaatctttgagaccaaattc
caggtggacaaggtcaacttccacatgtttgatgtgggtggccagcgtgacgaacgccgc
aagtggatccaatgcttcaatgatgtgactgccatcatcttcgtggtggccagcagcagc
tacaacatggtcattcgggaggacaaccagaccaaccgtcttcaggaggctctgaacctc
ttcaagagcatctggaacaacagatggctgcgcaccatctctgtgattctgttcctcaac
aagcaagacctgctcgctgagaaggtcctcgctgggaaatccaagattgaggactacttt
ccagaatttgctcgctacactactcctgaggatgctactcccgagcctggtgaggaccct
cgcgtgacccgggccaagtacttcatccgcgatgaatttctgagaatcagcactgccagt
ggagacgggcgccactactgctacccccacttcacctgcgctgtggacaccgaaaacatt
cgtcgcgtgttcaacgattgccgtgacatcatccagcgcatgcaccttcgtcagtacgag
ctgctgtga

KEGG   Loxodonta africana (African savanna elephant): 100669226
Entry
100669226         CDS       T04351                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04072  Phospholipase D signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04714  Thermogenesis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04976  Bile secretion
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05034  Alcoholism
lav05142  Chagas disease
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100669226
   04020 Calcium signaling pathway
    100669226
   04072 Phospholipase D signaling pathway
    100669226
   04024 cAMP signaling pathway
    100669226
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100669226
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100669226
  09152 Endocrine system
   04911 Insulin secretion
    100669226
   04922 Glucagon signaling pathway
    100669226
   04923 Regulation of lipolysis in adipocytes
    100669226
   04912 GnRH signaling pathway
    100669226
   04913 Ovarian steroidogenesis
    100669226
   04915 Estrogen signaling pathway
    100669226
   04921 Oxytocin signaling pathway
    100669226
   04926 Relaxin signaling pathway
    100669226
   04935 Growth hormone synthesis, secretion and action
    100669226
   04918 Thyroid hormone synthesis
    100669226
   04928 Parathyroid hormone synthesis, secretion and action
    100669226
   04916 Melanogenesis
    100669226
   04924 Renin secretion
    100669226
   04925 Aldosterone synthesis and secretion
    100669226
   04927 Cortisol synthesis and secretion
    100669226
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100669226
   04270 Vascular smooth muscle contraction
    100669226
  09154 Digestive system
   04970 Salivary secretion
    100669226
   04971 Gastric acid secretion
    100669226
   04972 Pancreatic secretion
    100669226
   04976 Bile secretion
    100669226
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100669226
   04961 Endocrine and other factor-regulated calcium reabsorption
    100669226
  09156 Nervous system
   04724 Glutamatergic synapse
    100669226
   04728 Dopaminergic synapse
    100669226
   04726 Serotonergic synapse
    100669226
   04730 Long-term depression
    100669226
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100669226
  09159 Environmental adaptation
   04713 Circadian entrainment
    100669226
   04714 Thermogenesis
    100669226
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669226
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100669226
  09165 Substance dependence
   05030 Cocaine addiction
    100669226
   05031 Amphetamine addiction
    100669226
   05032 Morphine addiction
    100669226
   05034 Alcoholism
    100669226
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100669226
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100669226
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100669226
   05165 Human papillomavirus infection
    100669226
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100669226
   05142 Chagas disease
    100669226
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100669226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100669226
   04031 GTP-binding proteins [BR:lav04031]
    100669226
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100669226
  Exosomal proteins of other body fluids (saliva and urine)
   100669226
  Exosomal proteins of colorectal cancer cells
   100669226
  Exosomal proteins of bladder cancer cells
   100669226
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100669226
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 100669226
NCBI-ProteinID: XP_003419969
UniProt: G3TLL4
LinkDB
Position
Unknown
AA seq 247 aa
MDRRSRAYQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
QRRSFLNAHHRSAAQVVPEPPESDQEQDEGELDLSLIECLEYEEEFDYESETETESEIEY
ETDFETDFETETAPTTEPETEPEDERSPVVPKRPTFGQSLTERLNALKLRSPDASPSRAQ
PSTQEPQSPTEGEVPVPEQKDPRDPEDPKEEQKKQRRRCKPKSKKSSRRDPSPEPPSKRG
PIPIRRH
NT seq 744 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggcttaccagtggcgccgagctcgccacaattacaacgacctg
tgcccgcccatcggccgccgggccgccaccgcgctcctctggctctcctgctccatcgca
ctcctccgcgccctagccacctccaacgcccgagcccagcagcgtgcggcagcccaacag
cagcgccggagcttccttaacgcccaccaccgctccgccgcccaggtggtccctgagccc
cccgagtctgaccaggagcaggacgagggtgagctcgacctgtcccttatcgagtgcctc
gagtacgaggaagagttcgactacgagtcggagaccgagaccgagtccgaaatcgagtac
gagaccgacttcgagaccgacttcgagaccgagaccgccccaaccactgagccggagacc
gagcccgaggacgagcgcagcccggtggtgcccaagcgccccaccttcggccaatctctc
accgagcgtctgaacgcgctcaagttgcggagccccgacgcctccccaagtcgcgcgcag
cccagcactcaggagccccagagccccaccgagggtgaggtgcccgtgcccgagcaaaag
gatccgcgggaccccgaggaccccaaagaagagcagaagaagcagcggcgtcgctgcaag
cccaagtccaagaagtccagccgccgcgacccatctccggagcccccttccaagagggga
cccatccccatccggcgtcactaa

DBGET integrated database retrieval system