KEGG   Loxodonta africana (African savanna elephant): 100655298Help
Entry
100655298         CDS       T04351                                 

Gene name
TMPRSS2
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05164  Influenza A
lav05202  Transcriptional misregulation in cancer
lav05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100655298 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    100655298 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    100655298 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lav01002]
    100655298 (TMPRSS2)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100655298 (TMPRSS2)
Peptidases [BR:lav01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100655298 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Trypsin_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 100655298
NCBI-ProteinID: XP_023414879
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MALDSGSPTGVGPYYENHGYQPENFYPLQPPAAPGAYPAYPAQYYPSPVPQYVPTVLTHA
STPAIHQQPNPPSGTVRTSRTKRALCVTFALGAILAAVVLAAILLWRFLDKCSGSGVECG
SSGTCISASNWCDGISHCPSGEDENRCVRLYGPNFILQVYSAPRNSWHPVCWDNWRESYA
WAACGDMGYKQSFYSSQGVVDDSGATSFLKLNTSVGSTDLYKRLFHSTTCSSKTVVSLRC
IECGVTSSMTHQSRIVGGESAALGAWPWQVSLHVQGVHVCGGSIITPQWIVTAAHCVEEP
LSSPWYWTAFAGILKQSSMVYGSGHQVEKVISHPNYDSKTKNNDVALMKLQAPLTFNDRV
SPVCLPNPGLMLEPTQTCWISGWGATQEKGKTSNELNAAKVPLIETWICNNRYIYNDLVT
PTMICAGYLEGNIDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKVNRPGVYGNMTVFT
DWIYQQMRVISPTAPPP
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctttagactcagggtcaccaacgggtgttggaccttactatgaaaaccacggatac
cagccagagaacttctaccccctgcagccccctgctgctcccggtgcctacccagcatac
ccggcccagtactatccatcccccgtgccccagtacgtcccgacggttctgacgcatgct
tcgacacccgccatccaccagcagcccaacccgccatcagggactgtgcgcacctcaaga
accaagagagcactctgtgtcacctttgcactgggggccatccttgctgccgtggtgctg
gccgccatcctgctctggaggttcttggacaagtgctctggctcaggagtagagtgtggc
tcttctggaacctgcatcagcgcctcgaactggtgtgatggcatctcacactgccccagc
ggggaggatgagaaccgctgcgtgcgcctctacggacccaacttcatcctgcaggtgtac
tcggccccgaggaactcctggcaccccgtgtgctgggacaactggcgcgagagctatgca
tgggcagcctgcggagacatgggctacaagcaaagtttttactccagccaaggtgtggtg
gatgacagcggtgccaccagctttctgaagctgaacaccagtgttggaagtaccgacctg
tataagagactgttccacagcactacctgttcttcaaagacagtggtgtctttacgctgt
atagagtgcggggtcacctccagtatgacccaccagagccggatcgtggggggtgaaagc
gccgccctgggggcctggccttggcaggtcagcctgcatgtccaaggcgtccatgtctgc
ggaggttccatcatcaccccccagtggatcgtgacggctgcgcactgtgtggaagaacct
ctttccagcccatggtattggacagccttcgcggggattttgaagcagtcttccatggta
tatggaagtgggcaccaagtagagaaagttatttctcatccaaattatgattccaagacc
aagaacaatgacgttgctcttatgaagttgcaggcaccgctgacctttaacgacagagta
agtcctgtgtgtctgcccaacccgggcttgatgctggagcccacgcagacctgctggatt
tctgggtggggtgccacccaagagaaagggaaaacctccaacgagctgaatgcagccaaa
gtgcccctcatcgagacctggatatgtaacaacagatacatctacaatgacctcgtcact
cctaccatgatctgcgcagggtacctggagggaaacatcgactcctgccagggtgacagt
ggaggtcctctggtcactttgaagagcagcgtctggtggttgattggggacacgagctgg
ggatccggatgtgccaaggtgaacaggccaggcgtgtatggaaacatgacagtattcaca
gactggatttaccaacaaatgagggtaatttcccccacagctcctcctccctga

DBGET integrated database retrieval system