KEGG   Loxodonta africana (African savanna elephant): 100655386
Entry
100655386         CDS       T04351                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04071  Sphingolipid signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04666  Fc gamma R-mediated phagocytosis
lav04750  Inflammatory mediator regulation of TRP channels
lav04925  Aldosterone synthesis and secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100655386 (PRKCE)
   04071 Sphingolipid signaling pathway
    100655386 (PRKCE)
   04022 cGMP-PKG signaling pathway
    100655386 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100655386 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100655386 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100655386 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100655386 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100655386 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100655386 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100655386 (PRKCE)
   04931 Insulin resistance
    100655386 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100655386 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655386 (PRKCE)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100655386 (PRKCE)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100655386 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100655386
NCBI-ProteinID: XP_023412942
LinkDB
Position
Unknown
AA seq 689 aa
MTVVVVTVVVVLMVVVALVEAEVIVTAMVMVVMMGVVTVVGVVEVMMVVTKMMMEGSLYL
HVKVHSTSTGLVLGLTKPQFSLLCSCSSPAPKDNEERVFRERLRPRKRQGAVRRRVHQVN
GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQET
PDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNV
APNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPTEEDRSKSAP
TSPCDQEIKELENNIRKALSFDNRGEDHRAAASTDGQLASPGENGEVRQGQAKRLGLDEF
NFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPY
LTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGV
IYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSV
DWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHK
RLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPV
LTLVDEAIVKQINQEEFKGFSYFGEDLMP
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgacggtggtggtggtgacagtggtggtggtattgatggtggtggtggcgctagtcgag
gcagaggtgatagttacggccatggtgatggtggtgatgatgggagtggtgacagtggtg
ggggtagtggaggtgatgatggtggttacgaagatgatgatggaggggagtttgtacttg
cacgtcaaagtccactcaacgtcaactggtttggttttgggtctaaccaagcctcagttc
tctcttctctgctcttgttcttccccagcccctaaggacaatgaagaacgtgtattcagg
gaacgcttgcggccgaggaagcggcagggcgccgtcaggcgcagggtccaccaggtcaac
ggccacaagttcatggccacctaccttcggcagcccacctactgctcccactgcagagat
ttcatctggggtgtcatagggaagcagggataccaatgtcaagtttgcacatgcgtggtc
cacaagcggtgtcatgagcttataatcacgaagtgtgctggattaaagaaacaggaaaca
cccgatgaggtgggctcccagcggttcagcgtcaacatgccccacaagtttggtatccac
aactacaaggtccccaccttctgtgaccactgtgggtccctgctctggggcctcttgcgg
cagggcttgcaatgtaaagtctgcaagatgaacgttcaccgtcgctgtgagaccaatgtt
gcccccaactgtggagtagatgccagaggaattgccaaggtgctggccgacctcggtgtc
actccagacaagatcaccaacagtggccagaggaggaaaaagctcattgctggtgccgag
tccccacagcctgcttctggaagctcaccaactgaggaagatcgatccaagtcagcaccc
acctccccttgtgaccaggaaataaaagaacttgaaaacaacattcggaaggctttgtca
tttgacaatcgtggggaggatcaccgggcggccgcgtccaccgacggccagctggcgagc
cctggagagaacggggaagtccggcagggccaggccaagcgcttgggcctggatgagttc
aacttcatcaaggtgttgggcaaaggcagctttggcaaggtcatgttggcggaactcaag
ggcaaagatgaagtctatgctgtgaaggtcttaaagaaggacgtcatccttcaggatgat
gacgtggactgcacgatgacagagaagagaattttggctctggcacggaaacacccgtac
ctaacccaactctattgctgcttccagaccaaggaccgcctctttttcgtcatggaatat
gtcaatggtggagacctcatgtttcagattcagcgctcccgaaaatttgatgagccccgc
tcacggttctatgctgcagaggtcacctcggccctcatgttcctccaccaacatggagtc
atctacagggatttgaaactggacaacatcctactagatgcggaaggtcactgcaagctg
gctgactttggaatgtgcaaggaagggattctgaacggtgtgacaaccaccacgttctgt
gggactcctgactacatagcccccgagatcctacaggagttggagtatggcccttcggtg
gactggtgggccctgggggtactgatgtatgagatgatggctgggcagcccccgtttgag
gctgacaatgaggacgacctctttgagtccatccttcatgatgacgtgctgtacccggtc
tggctcagcaaggaggctgtcagcatcttgaaagcgtttatgaccaagaacccacacaag
cgcctgggctgtgtggcagcacagaatggggaggacgccatcaagcagcaccctttcttc
aaggagatcgactgggtgcttctggagcagaagaagatcaagccgcccttcaagcctcga
atcaaaaccaaaagagacgtcaataactttgaccaagactttacccgggaagagccggta
ctcacgctcgtggatgaagcgattgtgaagcagatcaaccaggaggaattcaaaggcttt
tcctactttggtgaagacctgatgccgtga

DBGET integrated database retrieval system