KEGG   Loxodonta africana (African savanna elephant): 100655386
Entry
100655386         CDS       T04351                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04071  Sphingolipid signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04530  Tight junction
lav04666  Fc gamma R-mediated phagocytosis
lav04750  Inflammatory mediator regulation of TRP channels
lav04925  Aldosterone synthesis and secretion
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100655386 (PRKCE)
   04071 Sphingolipid signaling pathway
    100655386 (PRKCE)
   04022 cGMP-PKG signaling pathway
    100655386 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100655386 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100655386 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100655386 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100655386 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100655386 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100655386 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100655386 (PRKCE)
   04931 Insulin resistance
    100655386 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100655386 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655386 (PRKCE)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100655386 (PRKCE)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100655386 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100655386
NCBI-ProteinID: XP_023412942
LinkDB
Position
Unknown
AA seq 689 aa
MTVVVVTVVVVLMVVVALVEAEVIVTAMVMVVMMGVVTVVGVVEVMMVVTKMMMEGSLYL
HVKVHSTSTGLVLGLTKPQFSLLCSCSSPAPKDNEERVFRERLRPRKRQGAVRRRVHQVN
GHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQET
PDEVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNV
APNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPTEEDRSKSAP
TSPCDQEIKELENNIRKALSFDNRGEDHRAAASTDGQLASPGENGEVRQGQAKRLGLDEF
NFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPY
LTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGV
IYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSV
DWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHK
RLGCVAAQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPV
LTLVDEAIVKQINQEEFKGFSYFGEDLMP
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgacggtggtggtggtgacagtggtggtggtattgatggtggtggtggcgctagtcgag
gcagaggtgatagttacggccatggtgatggtggtgatgatgggagtggtgacagtggtg
ggggtagtggaggtgatgatggtggttacgaagatgatgatggaggggagtttgtacttg
cacgtcaaagtccactcaacgtcaactggtttggttttgggtctaaccaagcctcagttc
tctcttctctgctcttgttcttccccagcccctaaggacaatgaagaacgtgtattcagg
gaacgcttgcggccgaggaagcggcagggcgccgtcaggcgcagggtccaccaggtcaac
ggccacaagttcatggccacctaccttcggcagcccacctactgctcccactgcagagat
ttcatctggggtgtcatagggaagcagggataccaatgtcaagtttgcacatgcgtggtc
cacaagcggtgtcatgagcttataatcacgaagtgtgctggattaaagaaacaggaaaca
cccgatgaggtgggctcccagcggttcagcgtcaacatgccccacaagtttggtatccac
aactacaaggtccccaccttctgtgaccactgtgggtccctgctctggggcctcttgcgg
cagggcttgcaatgtaaagtctgcaagatgaacgttcaccgtcgctgtgagaccaatgtt
gcccccaactgtggagtagatgccagaggaattgccaaggtgctggccgacctcggtgtc
actccagacaagatcaccaacagtggccagaggaggaaaaagctcattgctggtgccgag
tccccacagcctgcttctggaagctcaccaactgaggaagatcgatccaagtcagcaccc
acctccccttgtgaccaggaaataaaagaacttgaaaacaacattcggaaggctttgtca
tttgacaatcgtggggaggatcaccgggcggccgcgtccaccgacggccagctggcgagc
cctggagagaacggggaagtccggcagggccaggccaagcgcttgggcctggatgagttc
aacttcatcaaggtgttgggcaaaggcagctttggcaaggtcatgttggcggaactcaag
ggcaaagatgaagtctatgctgtgaaggtcttaaagaaggacgtcatccttcaggatgat
gacgtggactgcacgatgacagagaagagaattttggctctggcacggaaacacccgtac
ctaacccaactctattgctgcttccagaccaaggaccgcctctttttcgtcatggaatat
gtcaatggtggagacctcatgtttcagattcagcgctcccgaaaatttgatgagccccgc
tcacggttctatgctgcagaggtcacctcggccctcatgttcctccaccaacatggagtc
atctacagggatttgaaactggacaacatcctactagatgcggaaggtcactgcaagctg
gctgactttggaatgtgcaaggaagggattctgaacggtgtgacaaccaccacgttctgt
gggactcctgactacatagcccccgagatcctacaggagttggagtatggcccttcggtg
gactggtgggccctgggggtactgatgtatgagatgatggctgggcagcccccgtttgag
gctgacaatgaggacgacctctttgagtccatccttcatgatgacgtgctgtacccggtc
tggctcagcaaggaggctgtcagcatcttgaaagcgtttatgaccaagaacccacacaag
cgcctgggctgtgtggcagcacagaatggggaggacgccatcaagcagcaccctttcttc
aaggagatcgactgggtgcttctggagcagaagaagatcaagccgcccttcaagcctcga
atcaaaaccaaaagagacgtcaataactttgaccaagactttacccgggaagagccggta
ctcacgctcgtggatgaagcgattgtgaagcagatcaaccaggaggaattcaaaggcttt
tcctactttggtgaagacctgatgccgtga

KEGG   Loxodonta africana (African savanna elephant): 100657357
Entry
100657357         CDS       T04351                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta type
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04140  Autophagy - animal
lav04270  Vascular smooth muscle contraction
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04750  Inflammatory mediator regulation of TRP channels
lav04920  Adipocytokine signaling pathway
lav04931  Insulin resistance
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100657357 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100657357 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100657357 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    100657357 (PRKCQ)
   04659 Th17 cell differentiation
    100657357 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100657357 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100657357 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100657357 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100657357 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100657357 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100657357 (PRKCQ)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100657357 (PRKCQ)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100657357 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING_9 Kinase-like Zf_RING zf-RING-like C1_2 APH
Other DBs
NCBI-GeneID: 100657357
NCBI-ProteinID: XP_003410641
UniProt: G3SNX2
LinkDB
Position
Unknown
AA seq 706 aa
MSPFLRIGLSNFDCGSCQPCQGEAVNPYCAVLVKEYVESENGQMYVQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEVWLELKPQGRMLMNAR
YFLEMSDTKDLSEFETEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHKCQTKVANLCGINQKLMAEALAMIESTQQ
ARSLRDTEHIFREGPVEIGLPRSMKEETRLPYLPTPGKREPQGISWDSPMDGMDKVCHPP
EPEPSIERPSIHLKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQICHKFDLCR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDARTNTFC
GTPDYIAPEILLGQKYNHSVDWWTFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIREHPLFQEINWEELERKEIEPPFKPKVKSPYD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFINPGMERLIS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtcaccatttcttcgaattggtttgtccaactttgactgtgggtcctgccagccctgt
cagggagaagctgttaacccttactgtgctgtgcttgtcaaagaatatgttgaatcagag
aatgggcaaatgtatgttcagaagaagccaaccatgtaccccccgtgggacagcactttt
gatgcccatataaacaaggggagagtaatgcagatcattgtgaagggcaaaaatgtggac
ctaatatctgaaactacagtagagctctactccctggccgagagatgcaggaagaacaat
gggaagacagaagtatggttagaactgaaacctcaaggccgaatgctaatgaacgcaaga
tactttctggaaatgagtgacacaaaggacttgagtgaatttgagactgaaggcttcttt
gctttgcatcaccgtcgaggagccatcaaacaggccaaagtccatcacgtcaagtgtcat
gagttcactgccaccttttttccacaacccactttttgctccgtttgccatgagtttgtc
tggggtctgaacaaacagggctaccagtgccgacaatgtaatgcagccattcacaagaag
tgtatcgataaagttatagctaaatgcacaggatcagctatcaacagtcgagaaaccatg
ttccacaaggagcgattcaaaattgacatgccacatcgatttaaagtctacaattacaag
agcccaactttctgtgagcactgtgggactctgttgtggggattggcaagacaaggactg
aagtgtgatgcatgtggcatgaacgtccatcacaaatgccagacaaaggtggccaacctt
tgtggcataaaccagaagctaatggccgaagccctggcaatgattgagagcactcagcag
gctcgcagcttaagagacactgagcatatcttcagagaaggtccagttgaaattggtctc
ccacgctccatgaaagaagaaacaaggctgccatacttaccaacaccagggaaaagagag
cctcaaggaatatcctgggattctccaatggatgggatggataaagtatgccatcctcca
gaacctgaaccaagcatagaaagaccgtctatacatctgaaattgaaaattgaggatttt
atcttgcacaaaatgttggggaaaggaagttttggcaaggtcttcctagcagagttcaag
aaaaccaatcagttttttgcaataaaagccttaaagaaagatgtggtcttgatggatgac
gatgtggagtgtacaatggtggagaagagagtcctctcgttggcctgggagcatccattt
ttaacgcacatgttttgtacattccagaccaaggaaaacctcttttttgtgatggagtat
ctcaacggaggagacttaatgtaccacatccagatctgccacaagtttgatctttgcaga
gcgacgttttatgctgctgaaattatccttggtctgcagttcctgcattccaaaggaatt
gtctacagggacctgaagctggataatatcctgttagacaaagacggacatatcaaaata
gcagactttgggatgtgcaaggagaacatgttaggagatgcgaggacaaacactttctgc
ggaactcctgactacatcgccccggagatcttgctgggtcagaaatacaaccattctgtt
gactggtggacctttggtgttctcctctatgagatgctcataggtcagtcacctttccat
gggcaagatgaagaagagctgttccactccatccgcatggacaatcccttctacccaaga
tggcttgagaaggaagccaaagaccttttagtgaagctctttgtgagagaacctgaaaag
aggttgggagtgaggggagacatccgcgagcatcctttgtttcaggagatcaattgggaa
gagcttgaaagaaaggagattgaaccacctttcaagcctaaagtgaaatcaccatatgac
tgcagcaatttcgacaaagaattcctgaatgagaaaccccggctatcattcgctgacaga
gcactcatcaacagtatggaccagaacatgttcagaaacttttctttcattaacccaggg
atggagaggctgatatcctga

KEGG   Loxodonta africana (African savanna elephant): 100659245
Entry
100659245         CDS       T04351                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X2
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04140  Autophagy - animal
lav04270  Vascular smooth muscle contraction
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04722  Neurotrophin signaling pathway
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05020  Prion disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100659245 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100659245 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    100659245 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    100659245 (PRKCD)
   04062 Chemokine signaling pathway
    100659245 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100659245 (PRKCD)
   04915 Estrogen signaling pathway
    100659245 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100659245 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100659245 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100659245 (PRKCD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100659245 (PRKCD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100659245 (PRKCD)
   04931 Insulin resistance
    100659245 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100659245 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100659245 (PRKCD)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100659245 (PRKCD)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100659245 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 Zf_RING zf-RING-like Kinase-like zf-RING_9 PHD Pkinase_fungal APH DUF2318 DZR
Other DBs
NCBI-GeneID: 100659245
NCBI-ProteinID: XP_003410103
UniProt: G5E721
LinkDB
Position
Unknown
AA seq 676 aa
MAPFLRIAFNSYELGSLQATDEVNQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSSFD
AHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSIRGEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTMFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCADCGMNVHHKCQKKVANLCGINQKLLAEALNQVSQRSSR
RSDSGSSEPVGIYQSFEKKPGLSGYDGPDNSGTYGKIWEGSTRCTIENFTFHKVLGKGSF
GKVLLAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLFCTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEILCGLQFLHSKGIIYRDLKLDNVM
LDRDGHIKIADFGMCKENVFGENRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFERDPPRRLGVTGNIKIH
PFFKTINWTLLEKRQVEPPFKPKVKSPGDYSNFDQEFLNEKARLSYSDKNLIDSMDQTAF
AGFSFVNPKFEHLLEN
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcgccattcctgcgcatcgctttcaactcctatgagctgggctccctgcaggccacg
gatgaggtgaaccagcccttctgtgccgtgaagatgaaggaggcactcagcacagagcga
gggaagacactggtgcagaagaagccgaccatgtatcctgagtggaagtcatcgtttgac
gcccacatctatgagggccgcgtcatccagattgtgctgatgcgggcggccgaagaccca
gtgtccgaggtgaccgtgggcgtgtcggtgctggccgagcgctgcaagaagaacaacggc
aaggccgagttctggctggaccttcaaccccaggccaaggtgttgatgtcagtgcaatat
ttcttggaagacgtggattgcaagcagtctattcggggtgaggacgaggccaagttccct
acaatgaaccgccgtggagccatcaaacaggccaaaatccactacatcaagaaccacgag
ttcattgccaccttctttgggcaacccaccttctgttctgtgtgcaaggaattcgtctgg
ggtctcaacaagcaaggctacaaatgcaggcaatgcaatgctgctatccacaagaaatgt
atcgacaagatcatcggccggtgcactggtaccgcggccaacagccgggacaccatgttc
cagaaagaacgcttcaacattgacatgccacaccggttcaaggtgtacaactacatgagc
cccaccttctgtgaccactgtggcagtctgctctgggggctggtgaagcaaggattaaag
tgcgcagactgtggcatgaatgtacaccacaagtgccagaagaaggtagccaacctctgc
ggtatcaaccagaagctcttggctgaggcactgaaccaagtcagccagagatcctcccgc
aggtcggattcagggtcttcagagcctgttgggatctaccagagtttcgagaagaagcca
gggctttctgggtatgatggcccagacaacagcgggacctatggcaagatctgggagggc
agcaccaggtgtaccattgagaacttcaccttccacaaggtcctgggcaaaggcagcttc
ggaaaggtgctgcttgcagagctgaagggcaaaaaggaattcttcgctatcaaggccctt
aagaaggacgtggttctgattgatgatgacgtggagtgcaccatggtggagaagcgggtg
ctggcactcgcatgggagaacccctttctcacccatctgttctgcaccttccagaccaag
gaccacctgttttttgtgatggagttcctcaacgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgcgccacgttttatgcagccgagatcctctgtggc
ctgcagtttctccacagcaaaggaatcatctacagggacctcaagctggacaatgtgatg
ctggaccgggacggccacatcaagattgctgactttggaatgtgcaaggagaacgtattt
ggggagaaccgggccagcaccttctgtggcactcctgactacattgctcccgagatcctg
cagggcctgaagtactccttctccgtggactggtggtccttcggggtccttctctatgag
atgctcattggccagtctcccttccacggtgacgatgaggatgaactcttcgagtccatc
cgtgtggacacgccacattacccccgctggattaccaaggagtccaaggacattctggag
aagctgtttgaacgggacccacccaggaggctgggagtgacagggaacatcaaaatccac
cccttcttcaagaccatcaactggactctgctggagaagcggcaggtggagccacccttc
aagcccaaagtgaagtcacctggggactatagcaacttcgaccaggagttcctgaatgag
aaggcacggctctcctacagcgacaagaacctcatcgactccatggaccagacggcgttt
gctggcttctcctttgtgaaccccaaatttgagcacctcctggaaaattga

KEGG   Loxodonta africana (African savanna elephant): 100659328
Entry
100659328         CDS       T04351                                 

Gene name
PRKCH
Definition
(RefSeq) protein kinase C eta type
  KO
K18051  novel protein kinase C eta type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100659328 (PRKCH)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100659328 (PRKCH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100659328 (PRKCH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100659328 (PRKCH)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100659328 (PRKCH)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100659328 (PRKCH)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100659328 (PRKCH)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 100659328
NCBI-ProteinID: XP_023402391
LinkDB
Position
Unknown
AA seq 697 aa
MSSSTMKFNGYLRVRIGEAVGLQPTRWSLRHSIFKKGYQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTAGTSDTFEG
WIDLEPEGKVFVVITLAGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQVNGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFNVHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESTKEGNGVGVNSSNRFGIDNFEFIRV
LGKGSFGKVMLARIKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHEKGIIYRCI
YCFLEEQLDPLEIQQEKGLPPCLWVEGWELATAQRPRRPPSCLLPDAHSISNVASLAQIL
QEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILK
SFMTKNPTMRLGSLPQGGEQAILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDP
DFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQL
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgtcgtccagcaccatgaagttcaatggctacttgagggtccgcatcggcgaggctgtg
gggctgcagcccacccgctggtctctgcgccactcaatcttcaagaagggctaccaactg
ctggacccctacctgacggtgagcgtggaccaggtgcgcgtgggccaaaccagcaccaag
cagaagaccaacaaacccacgtacaacgaggaattctgcgctaatgttaccgacggcggc
cacctcgaacttgctgtctttcacgagacacccctgggttacgaccacttcgtggctaac
tgcaccctgcaattccaggagctgctgcgtacggccggcacctcagacaccttcgagggc
tggattgatttggagccggaggggaaggtatttgtggtaataaccctagcagggagtttc
actgaagctactctccagagagaccgaatcttcaagcattttaccagaaagcgccagagg
gctatgcgaaggcgagtccaccaggtcaacggacataagttcatggccacgtacctaagg
cagcccacgtactgctctcactgcagggaattcatctggggagtctttgggaaacagggg
tatcaatgccaagtgtgcacctgtgttgtccataagcgctgccatcatctaattgttaca
gcctgtacttgccaaaacaacattaacaaagtggattcgaagattgctgaacagaggttt
ggaatcaacattccacataagttcaatgtccacaactacaaagtgccaacattttgcgat
cactgtggctccctgctctgggggataatgcgacaagggcttcagtgtaaaatatgtaaa
atgaatgtacatatccgatgtcaagcgaacgtggcccctaattgtggggtgaacgctgtg
gagctagccaagacactggccgggatgggtctccaacccggaaatatctctccgacctcg
aaacttgtttccagatcgaccttaagacgacaaggaaaggaaagcaccaaagaaggaaat
ggggtcggagttaattcttccaaccgatttggtatcgacaactttgagttcatccgagtg
ttggggaagggaagttttgggaaggtgatgcttgcaagaataaaagaaactggagacctc
tatgccgtgaaagtgctaaagaaggacgtgattctccaggacgatgacgtggaatgcaca
atgaccgagaagaggatcctgtctttggctcgcaatcaccccttcctcactcagctgttc
tgctgctttcagaccccggatcgtctgttttttgtaatggagtttgtgaatgggggcgac
ctgatgttccacatccagaagtctcgtcgctttgatgaagcccgagctcgtttctatgct
gcagaaatcatttcagcgctcatgttcttacatgagaaaggaatcatctataggtgcatt
tactgtttcttggaggaacaactggatcccctggagatacagcaggagaagggtctgccc
ccttgcctttgggtggaaggttgggagcttgccacggcccagagaccaagaagaccccct
agttgtttactaccagatgcacatagcatttctaatgttgcctccttggcacagatcctg
caggagatgctctacggacctgccgtggattggtgggcaatgggcgtgttgctctacgag
atgctctgtgggcatgcaccctttgaggccgagaacgaagatgacctctttgaggccata
ctgaatgacgaagtggtctaccctacctggctccatgaagatgccaccgggatcctaaaa
tctttcatgaccaagaaccccaccatgcgcttgggcagcctgcctcagggaggtgagcaa
gccatcctgagacatcctttctttaaggaaattgactgggcccaactgaaccatcgtcaa
ctagagccacctttcagacccagaatcaaatcccgagaagacgtcagtaatttcgaccct
gacttcataaaggaagagccagttttaaccccaattgatgagggacatcttcctatgatt
aaccaggatgaatttagaaacttttcctacgtatctccagaattgcaactgtaa

KEGG   Loxodonta africana (African savanna elephant): 100665537
Entry
100665537         CDS       T04351                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04613  Neutrophil extracellular trap formation
lav04650  Natural killer cell mediated cytotoxicity
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100665537 (PRKCA)
   04012 ErbB signaling pathway
    100665537 (PRKCA)
   04014 Ras signaling pathway
    100665537 (PRKCA)
   04015 Rap1 signaling pathway
    100665537 (PRKCA)
   04310 Wnt signaling pathway
    100665537 (PRKCA)
   04370 VEGF signaling pathway
    100665537 (PRKCA)
   04066 HIF-1 signaling pathway
    100665537 (PRKCA)
   04020 Calcium signaling pathway
    100665537 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100665537 (PRKCA)
   04072 Phospholipase D signaling pathway
    100665537 (PRKCA)
   04071 Sphingolipid signaling pathway
    100665537 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100665537 (PRKCA)
   04150 mTOR signaling pathway
    100665537 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100665537 (PRKCA)
   04540 Gap junction
    100665537 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100665537 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100665537 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100665537 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100665537 (PRKCA)
   04670 Leukocyte transendothelial migration
    100665537 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100665537 (PRKCA)
   04929 GnRH secretion
    100665537 (PRKCA)
   04912 GnRH signaling pathway
    100665537 (PRKCA)
   04921 Oxytocin signaling pathway
    100665537 (PRKCA)
   04926 Relaxin signaling pathway
    100665537 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100665537 (PRKCA)
   04918 Thyroid hormone synthesis
    100665537 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100665537 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100665537 (PRKCA)
   04916 Melanogenesis
    100665537 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100665537 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100665537 (PRKCA)
   04270 Vascular smooth muscle contraction
    100665537 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100665537 (PRKCA)
   04971 Gastric acid secretion
    100665537 (PRKCA)
   04972 Pancreatic secretion
    100665537 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100665537 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100665537 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100665537 (PRKCA)
   04727 GABAergic synapse
    100665537 (PRKCA)
   04725 Cholinergic synapse
    100665537 (PRKCA)
   04728 Dopaminergic synapse
    100665537 (PRKCA)
   04726 Serotonergic synapse
    100665537 (PRKCA)
   04720 Long-term potentiation
    100665537 (PRKCA)
   04730 Long-term depression
    100665537 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100665537 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100665537 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100665537 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100665537 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665537 (PRKCA)
   05206 MicroRNAs in cancer
    100665537 (PRKCA)
   05205 Proteoglycans in cancer
    100665537 (PRKCA)
   05231 Choline metabolism in cancer
    100665537 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100665537 (PRKCA)
   05214 Glioma
    100665537 (PRKCA)
   05223 Non-small cell lung cancer
    100665537 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100665537 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100665537 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100665537 (PRKCA)
   05032 Morphine addiction
    100665537 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100665537 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100665537 (PRKCA)
   05161 Hepatitis B
    100665537 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100665537 (PRKCA)
   05164 Influenza A
    100665537 (PRKCA)
   05163 Human cytomegalovirus infection
    100665537 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100665537 (PRKCA)
   05143 African trypanosomiasis
    100665537 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100665537 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665537 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100665537 (PRKCA)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100665537 (PRKCA)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100665537 (PRKCA)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100665537 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 100665537
NCBI-ProteinID: XP_003417343
UniProt: G3SWW4
LinkDB
Position
Unknown
AA seq 671 aa
MADVFPSNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLRVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNEAFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGT
EELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIAD
FGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYAKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRID
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNP
QFMHPILQSAV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccgtccaacgactccacggcgtctcaggacgtggccaaccggttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
tttgttactttttcttgcccgggtgccgataagggacctgacactgacgacccaaggagc
aagcacaaatttaaaatccacacttatggaagccccaccttctgtgatcattgtgggtca
ttgctgtacggactcattcaccaagggatgaaatgtgacacctgcgacatgaacgttcac
aagcagtgtgtaataaatgtccccagcctctgtggaatggatcacacagagaagagaggg
cgaatttacctgaaggctgaagttgctgatgagaagctccgcgtcacagtacgagatgca
aaaaatctaatccctatggatccaaatgggctttcagatccttacgtgaagctgaaactt
attcctgatcctaagaatgaaagcaaacaaaaaaccaaaaccatccgctctacactaaac
cctcagtggaatgaggccttcacattcaaattaaagccttcagacaaagaccgacgattg
tctgtagaaatctgggactgggatcgaacaacaagaaatgacttcatgggatccctttcc
tttggagtttcagagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccagaaggggatgaagaaggaaatatggag
ctcaggcagaaatttgagaaagccaagcttggccccgctgggaacaaagtgatcagtcct
tcagaagataggaaaccttccaacaacctggatcgagtaaaactcacggacttcaatttc
ctcatggtcctagggaaggggagttttggaaaggtgatgcttgctgacaggaagggcaca
gaagagctgtatgctatcaagattctcaagaaggacgtggtgatccaggatgacgacgtg
gagtgcaccatggtggagaagcgagttctggccctgctcgacaagcctccattcctgacg
cagctccactcctgcttccagacagtggatcgcctgtacttcgtcatggagtatgtcaac
ggtggggacctcatgtaccacattcagcaagtcgggaaatttaaggagccacaagcagta
ttctatgcagcagagatttccattggattgttctttcttcataaaagaggaatcatttat
agggatctgaaattagataatgtcatgctggattcggaaggacatatcaagattgccgac
tttgggatgtgcaaggagcacatgatggatggcgtcacaaccaggaccttctgtgggact
ccagattatattgccccggagataatcgcttatcagccgtatgcgaaatccgtggactgg
tgggcgtatggcgtcctattatacgaaatgctagctggccagcctccctttgatggcgaa
gatgaagatgaactctttcagtctataatggagcataacgtgtcctatccaaaatccttg
tccaaggaggccgtttccatctgcaaaggactgatgaccaaacaccccgccaagcggctg
ggctgtgggcctgagggtgagagggatgtaagagagcatgccttcttccggagaatcgac
tgggagaaactggagaaccgggagatccagccgccgttcaagcccaaagtgtgtggcaaa
ggagcagaaaactttgacaagttcttcacgcgagggcagcctgtcttaacgccgcctgac
cagctggtcattgctaatatagatcagtctgattttgaagggttctcatatgtcaacccc
cagtttatgcaccccatcttacagagcgcagtatga

KEGG   Loxodonta africana (African savanna elephant): 100671733
Entry
100671733         CDS       T04351                                 

Gene name
PRKCG
Definition
(RefSeq) LOW QUALITY PROTEIN: protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04066  HIF-1 signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04150  mTOR signaling pathway
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04613  Neutrophil extracellular trap formation
lav04650  Natural killer cell mediated cytotoxicity
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100671733 (PRKCG)
   04012 ErbB signaling pathway
    100671733 (PRKCG)
   04014 Ras signaling pathway
    100671733 (PRKCG)
   04015 Rap1 signaling pathway
    100671733 (PRKCG)
   04310 Wnt signaling pathway
    100671733 (PRKCG)
   04370 VEGF signaling pathway
    100671733 (PRKCG)
   04066 HIF-1 signaling pathway
    100671733 (PRKCG)
   04020 Calcium signaling pathway
    100671733 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100671733 (PRKCG)
   04071 Sphingolipid signaling pathway
    100671733 (PRKCG)
   04150 mTOR signaling pathway
    100671733 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100671733 (PRKCG)
   04540 Gap junction
    100671733 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100671733 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100671733 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100671733 (PRKCG)
   04670 Leukocyte transendothelial migration
    100671733 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100671733 (PRKCG)
   04929 GnRH secretion
    100671733 (PRKCG)
   04921 Oxytocin signaling pathway
    100671733 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100671733 (PRKCG)
   04918 Thyroid hormone synthesis
    100671733 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100671733 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100671733 (PRKCG)
   04916 Melanogenesis
    100671733 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100671733 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671733 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100671733 (PRKCG)
   04971 Gastric acid secretion
    100671733 (PRKCG)
   04972 Pancreatic secretion
    100671733 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100671733 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100671733 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100671733 (PRKCG)
   04727 GABAergic synapse
    100671733 (PRKCG)
   04725 Cholinergic synapse
    100671733 (PRKCG)
   04728 Dopaminergic synapse
    100671733 (PRKCG)
   04726 Serotonergic synapse
    100671733 (PRKCG)
   04720 Long-term potentiation
    100671733 (PRKCG)
   04730 Long-term depression
    100671733 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100671733 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100671733 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100671733 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671733 (PRKCG)
   05206 MicroRNAs in cancer
    100671733 (PRKCG)
   05205 Proteoglycans in cancer
    100671733 (PRKCG)
   05231 Choline metabolism in cancer
    100671733 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100671733 (PRKCG)
   05214 Glioma
    100671733 (PRKCG)
   05223 Non-small cell lung cancer
    100671733 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100671733 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100671733 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100671733 (PRKCG)
   05032 Morphine addiction
    100671733 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100671733 (PRKCG)
   05161 Hepatitis B
    100671733 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100671733 (PRKCG)
   05163 Human cytomegalovirus infection
    100671733 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100671733 (PRKCG)
   05143 African trypanosomiasis
    100671733 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100671733 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671733 (PRKCG)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100671733 (PRKCG)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100671733 (PRKCG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 100671733
NCBI-ProteinID: XP_003406900
LinkDB
Position
Unknown
AA seq 692 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWXVL
GAQTPVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSLLY
GLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEARN
LIPMDPNXLSDPYVELKLIPDPRRKTAQRSHGYRPSLRPPSSRSNLKPGDVERRLSVEVW
DWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEAC
NYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGVSPGRLHISDFSFLMVLGKGSFGKV
MLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQ
TPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDN
VMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLL
YEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGE
PTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASI
DQADFQGFTYVNPDFVHPDARSPTSPVPVQVM
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcgggcctgggccccggcgggggcgactcagaggggggaccccggcccctgttttgc
agaaagggtgctctgaggcagaaggtggttcacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggtgagtgctg
ggggcgcagacgcctgtctgcagctttgtggtgcaccggcgatgccacgaatttgtgacc
ttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaagcacaag
ttccgcctgcacagctacagcagccccaccttctgcgaccactgtggctccctcctttac
gggctggtgcaccagggcatgaaatgctcgtgctgtgagatgaacgtgcaccgtcgctgt
gtgcgaagcgtaccctccctgtgtggagtggaccacaccgagcgccgtgggcgcctgcag
ctggaaatccgggccccaacttccgatgaaattcacgtcacggtgggcgaggcccgtaac
ctcattccaatggaccctaatngtctatcggatccttatgtggaactgaagctcatccca
gaccctcggagaaagacagcccagaggagccatggctaccgtccctcactgcgccccccc
tcttcccgcagcaacctgaagcccggcgacgtggagcgtcggcttagcgtagaggtgtgg
gactgggaccgcacttcccgcaacgacttcatgggggccatgtcctttggggtgtcggag
cttctcaaggcgccagtggacggctggtacaagttactgaaccaggaggagggcgaatat
tataatgtaccggtggccgacgctgacaactgcagcctcctccagaagtttgaggcctgt
aactatcccctggaactatatgagcgggtgcggatgggcccgtcttcctcccccatcccc
tctccatcccccagtcccactgactccaaacgctgcttcttcggagtgagcccaggacgc
ctgcacatctcagacttcagcttcctcatggttctaggaaaaggcagcttcgggaaggtg
atgctggctgagcgcaggggctcagatgagctctacgctatcaagatcctgaagaaggac
gtgattgtccaggatgacgacgtggactgcaccctggtggaaaagcgcgtgctggcgcta
gggggccgaggcccaggcggccggccccactttctcactcagttgcactccaccttccag
accccggatcgcctgtatttcgtgatggagtatgtcactgggggcgacttgatgtaccac
attcagcaactgggcaaatttaaggagccccatgcagcgttctacgcagcagaaattgcc
attggcctcttcttccttcacaatcagggcatcatctaccgggacctgaaactggacaac
gtaatgctagatgcagaaggacacatcaaaattactgacttcggcatgtgcaaggagaac
gtcttccctgggaccaccacgcgcaccttctgcgggaccccggactacatagcccccgag
atcattgcctaccagccctatgggaagtccgtggattggtggtcctttggggttctactg
tatgagatgttggcgggacagcccccttttgacggggaggatgaagaggagctgtttcag
gccatcatggaacaaactgtcacctaccccaagtcgctctcccgggaagctgtggcaatc
tgcaaggggttcctgaccaagcacccggggaagcgcctgggctctgggccagatggggag
cccaccatccgtgctcatggatttttccgctggatcgactgggaacggctggagcggttg
gagattgcacctccgttcagaccccgcccgtgcggccgcagtggtgagaacttcgacaaa
ttcttcacacgggcagcgccagcgctgacccctccagaccgcctggtcctggccagcatc
gaccaggccgactttcagggcttcacctatgtgaaccctgatttcgtgcacccagatgcc
cgcagccccaccagcccagtgcccgtgcaagtcatgtaa

KEGG   Loxodonta africana (African savanna elephant): 100672078
Entry
100672078         CDS       T04351                                 

Gene name
PRKCB
Definition
(RefSeq) LOW QUALITY PROTEIN: protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04070  Phosphatidylinositol signaling system
lav04071  Sphingolipid signaling pathway
lav04150  mTOR signaling pathway
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04370  VEGF signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04613  Neutrophil extracellular trap formation
lav04650  Natural killer cell mediated cytotoxicity
lav04662  B cell receptor signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04960  Aldosterone-regulated sodium reabsorption
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav04973  Carbohydrate digestion and absorption
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
lav05032  Morphine addiction
lav05140  Leishmaniasis
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05214  Glioma
lav05223  Non-small cell lung cancer
lav05225  Hepatocellular carcinoma
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100672078 (PRKCB)
   04012 ErbB signaling pathway
    100672078 (PRKCB)
   04014 Ras signaling pathway
    100672078 (PRKCB)
   04015 Rap1 signaling pathway
    100672078 (PRKCB)
   04310 Wnt signaling pathway
    100672078 (PRKCB)
   04370 VEGF signaling pathway
    100672078 (PRKCB)
   04064 NF-kappa B signaling pathway
    100672078 (PRKCB)
   04066 HIF-1 signaling pathway
    100672078 (PRKCB)
   04020 Calcium signaling pathway
    100672078 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100672078 (PRKCB)
   04071 Sphingolipid signaling pathway
    100672078 (PRKCB)
   04150 mTOR signaling pathway
    100672078 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100672078 (PRKCB)
   04540 Gap junction
    100672078 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100672078 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100672078 (PRKCB)
   04662 B cell receptor signaling pathway
    100672078 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100672078 (PRKCB)
   04670 Leukocyte transendothelial migration
    100672078 (PRKCB)
   04062 Chemokine signaling pathway
    100672078 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100672078 (PRKCB)
   04929 GnRH secretion
    100672078 (PRKCB)
   04912 GnRH signaling pathway
    100672078 (PRKCB)
   04921 Oxytocin signaling pathway
    100672078 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100672078 (PRKCB)
   04918 Thyroid hormone synthesis
    100672078 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100672078 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100672078 (PRKCB)
   04916 Melanogenesis
    100672078 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100672078 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672078 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100672078 (PRKCB)
   04971 Gastric acid secretion
    100672078 (PRKCB)
   04972 Pancreatic secretion
    100672078 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100672078 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100672078 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100672078 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100672078 (PRKCB)
   04727 GABAergic synapse
    100672078 (PRKCB)
   04725 Cholinergic synapse
    100672078 (PRKCB)
   04728 Dopaminergic synapse
    100672078 (PRKCB)
   04726 Serotonergic synapse
    100672078 (PRKCB)
   04720 Long-term potentiation
    100672078 (PRKCB)
   04730 Long-term depression
    100672078 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100672078 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100672078 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100672078 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100672078 (PRKCB)
   05206 MicroRNAs in cancer
    100672078 (PRKCB)
   05205 Proteoglycans in cancer
    100672078 (PRKCB)
   05231 Choline metabolism in cancer
    100672078 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100672078 (PRKCB)
   05214 Glioma
    100672078 (PRKCB)
   05223 Non-small cell lung cancer
    100672078 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100672078 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100672078 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100672078 (PRKCB)
   05032 Morphine addiction
    100672078 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100672078 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100672078 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100672078 (PRKCB)
   05161 Hepatitis B
    100672078 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100672078 (PRKCB)
   05164 Influenza A
    100672078 (PRKCB)
   05163 Human cytomegalovirus infection
    100672078 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100672078 (PRKCB)
   05140 Leishmaniasis
    100672078 (PRKCB)
   05143 African trypanosomiasis
    100672078 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100672078 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100672078 (PRKCB)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100672078 (PRKCB)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100672078 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100672078
NCBI-ProteinID: XP_003418868
LinkDB
Position
Unknown
AA seq 671 aa
MADSAAGPSLSEGEEGTVRFARKGALWQNNVHEVKNHKFTARFFKQSSFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFKFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKINQGTKTPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGVIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgactcggctgcggggccatcgctaagcgagggcgaggagggcacggtgcgcttc
gcccgcaaaggcgctctctggcagaataacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagtcatctttctgcagtcactgcaccgacttcatctggggcttc
ggaaagcaagggttccagtgccaagtctgctgctttgttgtgcacaagcgatgccatgaa
tttgttaccttctcctgcccaggagctgacaagggtccagcctctgatgacccccggagc
aaacacaaatttaagatccacacatactccagccccacgttctgtgaccactgtgggtcc
ctactgtatgggctcatccaccaagggatgaagtgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctgtgcggcacagaccacacggagcgccgcgga
cgcatctatatccaggcccacatcgagagggaagtcctcattgtcgttgtaagagatgct
aaaaacctcgtacctatggaccccaatggcttgtcagatccctacgtaaaactgaaactg
attcctgatcccaaaagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaatgagacatttaaattccagctgaaagaatctgacaaagacagaagactg
tctgtagagatttgggattgggatctaaccagcaggaatgacttcatgggatcattgtca
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgccagtgccaccagaagggagtgaggccaacgaggaa
ctgcggcagaaatttgagagggccaagatcaatcaagggaccaagactccagaagaaaag
acaaccaacaccgtatccaaatttgacaacaatggcaacagggaccggatgaaactgact
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctccgag
cgaaaaggcacggacgagctgtatgccgtgaagatcctgaagaaggatgtggtgatccag
gatgacgatgtggagtgcacgatggtggagaagcgggtgctggccctgcccgggaagccc
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaatgggggtgacctgatgtaccacatccaacaagttggccggtttaaggag
cctcatgctgtattctacgctgcagagattgccatcggtctgttcttcttacagagcaag
ggcgtcatttaccgtgacctgaaacttgacaatgtgatgctggattccgagggccacatc
aagatcgctgattttggcatgtgtaaggaaaacatctgggacggggtgacaaccaagacg
ttctgtggcactccagactacatcgcccctgagataattgcctatcagccctatgggaag
tctgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcacct
ttcgaaggggaggatgaggatgagctcttccagtctatcatggaacacaacgtggcttat
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgcggacctgaaggtgaacgtgacatcaaagagcatgcatttttc
cggtatatcgattgggagaaacttgaacgcaaagagattcagcccccgtacaagccaaaa
gccagagacaagcgagacacctccaacttcgacaaagagttcaccagacagcctgtggaa
ctcactcccactgataaactcttcatcatgaacttggaccaaaatgagtttgctggcttc
tcctatactaatccagaatttgtcattaatgtgtag

DBGET integrated database retrieval system