KEGG   Loxodonta africana (African savanna elephant): 100655399Help
Entry
100655399         CDS       T04351                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05034  Alcoholism
lav05202  Transcriptional misregulation in cancer
lav05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:lav00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100655399
  Immune diseases
   05322 Systemic lupus erythematosus
    100655399
  Substance dependence
   05034 Alcoholism
    100655399
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100655399
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100655399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 100655399
NCBI-ProteinID: XP_023396021
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagacagctcgcaagtctaccggcggcaaagcgccgcgcaaacag
ttggccaccaaagctgcccgcaagagcgcgccggccactggcggcgtaaagaagcctcac
cgctaccggcccggcaccgtggcgctgcgcgagatcaggcgctaccagaagtcaactgaa
ctgctgattcgcaagctgcctttccagcggctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctctgcggttatggcactgcaggaggcgtgtgaggcctat
ctggtggggctctttgaggataccaacttgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgccgcattcgcggggagagagcctaa

DBGET integrated database retrieval system