KEGG   Loxodonta africana (African savanna elephant): 100655418
Entry
100655418         CDS       T04351                                 

Gene name
IRF7
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100655418 (IRF7)
   04621 NOD-like receptor signaling pathway
    100655418 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100655418 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100655418 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100655418 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100655418 (IRF7)
   05160 Hepatitis C
    100655418 (IRF7)
   05164 Influenza A
    100655418 (IRF7)
   05162 Measles
    100655418 (IRF7)
   05168 Herpes simplex virus 1 infection
    100655418 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655418 (IRF7)
   05169 Epstein-Barr virus infection
    100655418 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655418 (IRF7)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100655418 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100655418
NCBI-ProteinID: XP_023398114
LinkDB
Position
Unknown
AA seq 554 aa
MALASERGTPRVLFGEWLLHEISSGRYEGLRWLDAARTRFRVPWKHFARKDLEEADAHIF
KAWAVARGRWPPSNCAGTQPPPEAPERAGWKTNFRCALHSTRRFVMLQDNSGDPADPHKV
FAVSPAPGRRGPGIDRTEEAPADGWPMRGEPPGPFLGGEAGERPTPALDWASATRQSPEP
CTSNPLPARAGDTRDLLHQALQQSHLGDDLLEAAWRMDPAPQQPSGPVLACEELYLPWAV
EAAPNPPPQPPDQALMTGRRGAGNSEGEKGWSIRYQLSSGPSSSDACQTPASEPTQEVGP
APSLLTCTPLAGQQLGVGQRPARALAPTSGSWVYLCRFSRMTILYKGRLVLQEVVGLHXS
CVLLYQPPGPAAEATDVQLVAFPSPAELPDQKQLRYTEELLRHVDPGLQLELRGGSLWAR
RLGKCKVYWEVGGPLGSASPSSHACLLHRNFDTPIFDFGVFFRELVEFRERRRQGSPHYT
IYLGFGQDLSAGRPKEKSLVLVKLEPWLCRAYHEGAQREGTSSLDSSSLGLCLSSSNSLY
DDINHFLMELGQPA
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggccttggcttctgagagagggaccccacgcgtgctgttcggagagtggcttctgcac
gagatcagcagcggccgctacgaggggctgcggtggctggatgcggcccgtacgcgcttc
cgcgtgccctggaaacacttcgcacgcaaggatctggaagaggctgacgcgcacatcttc
aaggcgtgggctgtggcccgcggcaggtggccacccagcaactgcgcgggcacccagccg
ccccccgaagcaccagagcgcgccggctggaaaactaacttccgctgcgccctgcacagc
acgcggcgcttcgtgatgctgcaggacaactcgggagaccccgcggatccgcacaaggtg
tttgcggtcagccccgcgccgggaagaagaggcccaggcatcgacagaacagaagaggcc
cctgcagatggctggcccatgaggggtgagcctcctgggccattcctgggaggagaagct
ggtgagaggcccacacctgcattggattgggcttcagcaactaggcagagccctgagccc
tgtacctcaaaccctcttcccgcccgggctggtgacaccagggaccttctgcaccaggct
ctgcagcagagccaccttggagacgatttgctggaagcagcatggaggatggatccggcc
ccccagcagccttccggcccagtgctggcttgtgaggagctatacttgccgtgggcagtg
gaggcggcccccaaccccccaccacagccccccgaccaggccctgatgacaggtaggaga
ggggctgggaacagtgagggagagaagggctggtctatcaggtatcagctcagctcaggc
ccttcttcctcagatgcctgccagactcccgcctcagagcccacgcaggaggtggggcct
gcgccctctctcctcacctgtaccccactggcaggtcagcagctgggggtggggcaaagg
ccagccagggcccttgccccaaccagcggctcatgggtttatctgtgcagattttccaga
atgaccatcctgtacaagggccgcctggtgctgcaggaagtagtgggcctgcacnngagc
tgcgtgctcctgtaccagccccctggccccgctgccgaggccacagacgtgcagctggtg
gccttccccagcccagccgagctccccgaccagaagcagcttcgctacacggaggagctg
ctgcgacacgtggatccggggctgcagctggagctgcgcggaggcagcctgtgggcgcgg
cgcctgggcaaatgtaaggtgtactgggaggtgggcggccccctgggctctgccagcccc
tccagccacgcctgcctgctgcataggaacttcgacactcccatcttcgacttcggagtc
ttcttcagggagctggtggaattccgggaacggcggcgccagggctccccgcactatacc
atctacctgggctttgggcaggacctgtctgctgggaggccgaaggagaagagcctggtc
ctggtgaagctggagccatggctctgcagggcgtatcatgaaggcgcgcagcgtgagggc
acgtcctccctggacagcagcagcctcggcctctgcctgtccagctccaacagcctgtac
gatgacatcaaccacttcctcatggagctggggcagcctgcctag

DBGET integrated database retrieval system