KEGG   Loxodonta africana (African savanna elephant): 100655429
Entry
100655429         CDS       T04351                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05214  Glioma
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100655429 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100655429 (CDK6)
   04115 p53 signaling pathway
    100655429 (CDK6)
   04218 Cellular senescence
    100655429 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655429 (CDK6)
   05206 MicroRNAs in cancer
    100655429 (CDK6)
   05203 Viral carcinogenesis
    100655429 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100655429 (CDK6)
   05225 Hepatocellular carcinoma
    100655429 (CDK6)
   05214 Glioma
    100655429 (CDK6)
   05220 Chronic myeloid leukemia
    100655429 (CDK6)
   05218 Melanoma
    100655429 (CDK6)
   05224 Breast cancer
    100655429 (CDK6)
   05222 Small cell lung cancer
    100655429 (CDK6)
   05223 Non-small cell lung cancer
    100655429 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100655429 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100655429 (CDK6)
   05164 Influenza A
    100655429 (CDK6)
   05162 Measles
    100655429 (CDK6)
   05163 Human cytomegalovirus infection
    100655429 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655429 (CDK6)
   05169 Epstein-Barr virus infection
    100655429 (CDK6)
   05165 Human papillomavirus infection
    100655429 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655429 (CDK6)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100655429 (CDK6)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100655429 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 100655429
NCBI-ProteinID: XP_003407195
UniProt: G3TL01
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMLQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSHLPPGQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagtcgcgcggaccagcaatacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacttgaagaacggaggccgtttcgtg
gcgctgaagcgtgtgcgggtgcagactggcgaagagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgcacagtatcacgaacagacagagaaacgaaactaacattagtgtttgaacat
gttgatcaagacttgaccacttacttggataaggttccggagcctggagtgcccactgaa
accattaaggatatgatgcttcagcttctccgaggtctggactttcttcattctcaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggcctggcccggatctacagttttcagatggcgcttacgtcagtggtc
gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccctgtg
gatctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcctggatgtaattggactcccaggagaa
gaggactggcctagagatgttgctcttcccaggcaggctttccattcaaaatctccccaa
ccaattgagaagtttgtaacagatattgatgaactaggcaaagacctacttctgaagtgt
ctgacattcaatccagcgaaaagaatatctgcctacagtgccctgtctcacccatacttc
cacgacctggagaggtgcaaggagaacctggattcacatctgccgcctggccagaacacc
tcggagctgaacacagcctga

KEGG   Loxodonta africana (African savanna elephant): 104847103
Entry
104847103         CDS       T04351                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04110  Cell cycle
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04218  Cellular senescence
lav04530  Tight junction
lav04660  T cell receptor signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05214  Glioma
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104847103 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104847103 (CDK4)
   04115 p53 signaling pathway
    104847103 (CDK4)
   04218 Cellular senescence
    104847103 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104847103 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104847103 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104847103 (CDK4)
   05203 Viral carcinogenesis
    104847103 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104847103 (CDK4)
   05225 Hepatocellular carcinoma
    104847103 (CDK4)
   05214 Glioma
    104847103 (CDK4)
   05220 Chronic myeloid leukemia
    104847103 (CDK4)
   05218 Melanoma
    104847103 (CDK4)
   05219 Bladder cancer
    104847103 (CDK4)
   05224 Breast cancer
    104847103 (CDK4)
   05222 Small cell lung cancer
    104847103 (CDK4)
   05223 Non-small cell lung cancer
    104847103 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104847103 (CDK4)
   04934 Cushing syndrome
    104847103 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104847103 (CDK4)
   05160 Hepatitis C
    104847103 (CDK4)
   05164 Influenza A
    104847103 (CDK4)
   05162 Measles
    104847103 (CDK4)
   05163 Human cytomegalovirus infection
    104847103 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104847103 (CDK4)
   05169 Epstein-Barr virus infection
    104847103 (CDK4)
   05165 Human papillomavirus infection
    104847103 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104847103 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    104847103 (CDK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104847103 (CDK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104847103 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 104847103
NCBI-ProteinID: XP_010599575
LinkDB
Position
Unknown
AA seq 225 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGTGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSAYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGK
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccacccctcgatatgagccagtggctgagattggtgtcggtgcctatgggacggtg
tacaaggctcgtgatccccacagtggccactttgtggccctcaagagcgtgagagtcccc
aatggaggaggcactggagggggccttcctatcagcacagttcgtgaagtggccttactg
aggcggctggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
gcccgaactgatcgggaaaccaaggtaaccctggtatttgaacacgtggaccaagatcta
aggacctatctagacaaagcacccccaccaggcttgccagtggagaccatcaaggatcta
atgcgccagtttctaagaggccttgatttcctgcatgccaattgcattgttcaccgagac
ctgaagccagagaacatcctggtgacaagcggtggaaccgtcaagttggctgactttggg
ttggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctcctgaggttcttctgcagtctgcatatgcaacccctgtagacatgtggagtgta
ggctgtatcttcgcagagatgtttcgtcggaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaa

DBGET integrated database retrieval system