KEGG   Loxodonta africana (African savanna elephant): 100655451
Entry
100655451         CDS       T04351                                 

Gene name
CD82
Definition
(RefSeq) LOW QUALITY PROTEIN: CD82 antigen
  KO
K06509  CD82 antigen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100655451 (CD82)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100655451 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   100655451 (CD82)
  Exosomal proteins of colorectal cancer cells
   100655451 (CD82)
CD molecules [BR:lav04090]
 Proteins
  100655451 (CD82)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100655451
NCBI-ProteinID: XP_023406462
LinkDB
Position
Unknown
AA seq 265 aa
MGSACIKVTKYFLFLFNLLFFILGAVILGFGVWILVDKSSFISVLQTSDSSLKVGAYVFI
SVGAVTMLMCFLGCIGAVKEVRCLLGLYFALLLLILIAQVVAGTLFYFKMGKVKQEMGNA
VISLIRDYNSSRVDSLQDTWDYVQAQVGCCGWVNFYNWTENAELMDRTNITYPCSCEDKG
QEKDRPEKGFCEAPSNATLTGNNPEEWPMNREGCMKRVQEWLQENLGIILGVCVGVAVIE
VLGMLLSICLCRHIHSEDYSKVPKY
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggatcagcctgtatcaaagtcaccaaatactttctcttcctcttcaacttactcttc
tttatcctgggtgcagtgatcctgggcttcggggtgtggatcctggttgacaagagcagt
ttcatctctgtcctacagacttccgacagctcactcaaggtgggggcctacgtcttcatc
agcgtgggggccgtcaccatgctcatgtgcttcctgggctgtatcggtgccgtcaaagag
gtccgctgcctgctggggctgtactttgccctcctcctcctgatcctcattgcccaggtg
gttgctgggaccctcttctacttcaaaatgggcaaggtgaagcaggagatgggcaacgcc
gtgatcagcctcatccgggactacaacagcagccgggtggacagcctgcaggacacgtgg
gactacgtacaggcacaggtggggtgctgcggttgggtcaacttctacaactggacagag
aacgctgagcttatggatcgcaccaacatcacctacccctgttcctgtgaggacaagggg
caagagaaagacagacctgagaagggcttctgcgaggcgcccagcaatgccaccctgact
ggcaacaaccctgaagaatggcccatgaatagggagggctgcatgaagagagtgcaggaa
tggctgcaggagaacctgggcatcatcctgggcgtgtgtgtgggcgtagctgtcattgag
gtcctgggcatgcttctgtcaatctgcttgtgccggcacatccattccgaagactacagc
aaggtccccaagtactga

DBGET integrated database retrieval system