KEGG   Loxodonta africana (African savanna elephant): 100655521
Entry
100655521         CDS       T04351                                 

Gene name
RPRM
Definition
(RefSeq) protein reprimo
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100655521 (RPRM)
SSDB
Motif
Pfam: Tmemb_9 CobS
Other DBs
NCBI-GeneID: 100655521
NCBI-ProteinID: XP_010584616
UniProt: G3SNH5
LinkDB
Position
Unknown
AA seq 109 aa
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaatccggcgctgggcaaccagaccgacgtggcgggcctgttcctggccaacagcagc
gaggcgctggagcgcgcagtgcgctgctgcacccaggcgtccgtggtgaccgacgacggc
ttcgccgagggcggcccggacgagcgcagcctgtacatcatgcgcgtggtgcagatcgcc
gtcatgtgcgtgctctcgctcaccgtggtcttcggcatcttcttcctcggctgcaacctg
ctcatcaagtccgaaggcatgatcaacttcctggtgaaggaccggagaccgtctaaggag
gtggaggcggtggtcgtagggccctattga

DBGET integrated database retrieval system