KEGG   Loxodonta africana (African savanna elephant): 100655542
Entry
100655542         CDS       T04351                                 

Gene name
ATP2B2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04925  Aldosterone synthesis and secretion
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100655542 (ATP2B2)
   04024 cAMP signaling pathway
    100655542 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    100655542 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100655542 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100655542 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    100655542 (ATP2B2)
   04972 Pancreatic secretion
    100655542 (ATP2B2)
   04978 Mineral absorption
    100655542 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100655542 (ATP2B2)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100655542 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase EMC3_TMCO1
Other DBs
NCBI-GeneID: 100655542
NCBI-ProteinID: XP_023403837
LinkDB
Position
Unknown
AA seq 1267 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVKIKETYGDTEAICRRL
KTSPVEGLPGTTPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEACATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVIRANQVVQIPVAEIVVGDIAQVKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKKGDGLQLPAADGAAGSNAADSANAGLVNGKMQDGNVDASQSKAKQQDGAAAMEMQ
PLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDT
FVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNL
VRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSVNAKTMELLVN
AIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYEPVRIQMPEEKLYKVY
TFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKV
IEPMACDGLRTICVAYRDFPNSPEPDWDNENDILNDLTCICVVGIEDPVRPEVPEAIRKC
QRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDK
IWPKLRVLARSSPTDKHTLVKAAPPSEVAQGPEHAPAPQASLTATHTEQRQVVACCQSSW
PWCPAHLPLATPPRLPSLSPQGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIS
KFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLL
RKPYGRNKPLISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYT
IIFNTFVMMQLFNEVNARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSC
SPLQLDQWMWCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEI
DHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIE
DSQPHIPLIDDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPI
HSLETSL
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcacgatggaggagctccgctccctcatggagctgcggggcacc
gaggctgtggtcaagatcaaggagacctatggggacactgaagccatctgccggcgcctc
aagacctcgcctgttgaaggtttgccgggcaccactccagacctggaaaagagaaagcag
attttcgggcaaaactttatacctccaaagaagccaaaaaccttcctgcagcttgtatgg
gaagcgctgcaagatgtgaccctgatcatcctggaaatcgcagccatcatctccctgggg
ctctccttctaccatccgccaggcgagagcaatgaagcatgcgcgacggcccagggtggg
gcagaggatgaaggggaggcggaggcgggctggatcgagggggccgccatcctcctctca
gtcatctgtgtggtcctcgtcacggccttcaatgactggagcaaagagaaacagttccgg
ggccttcagagccgtatcgagcaggaacagaagtttactgtgatccgggccaaccaggtg
gtccagatccctgtggccgagatcgtggttggagacatcgcccaggtcaaatacggcgac
ctcctccctgctgacggcctcttcatccagggcaatgacctcaagattgacgaaagctcc
ctgaccggggagtctgaccaggtgcgcaagtctgtggacaaggaccccatgctgctgtca
gggacccacgtgatggagggctcaggacggatgttggtgaccgctgtgggtgtgaactct
cagactggcatcatctttaccttgctaggggctggtggtgaagaggaagaaaagaaagac
aagaaaggtgtgaagaagggggatggccttcagctaccagcagcagacggtgcggcaggt
tcaaatgctgcagatagtgccaatgccggcctagtcaatggtaaaatgcaggatggcaat
gtggacgccagccagagcaaagccaaacagcaggatggggcggccgccatggagatgcag
cccctcaagagcgccgagggcggcgacgcagatgacaagaagaaggccaacatgcacaaa
aaagagaagtccgtgctgcagggcaagctcacgaagctggctgtgcagattggcaaggca
ggcctggtgatgtcagccatcacggtcatcatcctggtgctctacttcaccgtggacacc
ttcgtggtcaacaagaagccatggctgcccgagtgcacgcccgtctacgtgcagtacttc
gtcaagttcttcatcattggcgtcacagtgctggtggtcgccgtgcccgaagggctccct
ctggctgtcaccatctcactggcctactcagtgaagaaaatgatgaaggacaacaacctg
gtgcgccacctggacgcctgtgagaccatgggcaatgccacggccatctgctcagacaag
actggcacgctgaccaccaatcgcatgacagtggtacaggcctacgttggtgacgtccac
tacaaggagatccccgaccccagctccgtcaatgctaagaccatggagctgctagtcaac
gccatcgccatcaacagcgcctacaccactaagatcctgcccccggagaaggagggcgcc
ctgcctcggcaggtgggcaacaagacagagtgtggcctgctgggctttgtgctggacctg
aagcaggactacgagcccgtgcgcatccagatgccagaggagaagctatacaaagtgtac
accttcaactccgtgcgcaagtcgatgagcacagtcatcaagctgcccgacgagagcttc
cgcatgtacagcaagggtgcttctgagatcgtgctcaagaagtgctgcaaaattctcaac
ggggcaggtgagccccgggtcttccggccccgcgaccgggatgagatggtgaagaaggtg
attgagcccatggcctgtgatgggctccgtaccatctgcgtggcctaccgcgacttcccc
aacagccccgagcccgactgggacaacgagaatgacatcctcaacgacctcacctgcatc
tgcgtggtgggcatcgaggaccccgtgcggcccgaggtcccggaagccattcgaaagtgc
cagcgggcaggcatcacggtccgcatggtcactggtgacaatatcaacacagcccgggcc
attgccatcaagtgtggcatcatccatcctggggaggacttcctgtgcctcgagggcaag
gagttcaaccggaggatccgcaatgagaagggggagattgagcaggagcgaatcgacaag
atctggccaaagctgcgagtgctggctcgctcctcccccacggacaagcataccctggtc
aaagctgccccaccttctgaggtggcccagggccctgagcacgcccctgccccacaggca
tcattgacagcgacccacaccgagcagcggcaggtggtggcctgttgccagagctcctgg
ccttggtgtccggctcaccttcccttggccaccccacccaggctcccgtccctgtcccca
cagggcatcgcaggtacagatgtggccaaggaggcctctgacatcatcctgactgacgac
aacttcagcagcatcgtcaaggctgtgatgtggggccgaaacgtctatgacagcatctcc
aagttcctgcagttccagctgacggtcaacgtggtggccgtgattgtggccttcacgggc
gcttgtatcacacaggattcccctctgaaggctgtgcagatgctctgggtgaacctcatc
atggacacgtttgcttccctggcactggccactgagccacccaccgagactctgcttctg
cggaagccatacggccgcaacaagcccctcatctcacgcaccatgatgaagaacatcctg
ggccatgctgtctaccagctcaccctcatcttcaccctgctctttgtgggcgagaagatg
tttcagattgacagtgggaggaacgcgcccctgcactccccgccctcggagcactacacc
atcatcttcaacaccttcgtcatgatgcagctcttcaacgaggtcaacgcccgcaagatc
catggcgagcgcaacgtctttgacggcatcttccggaaccccatcttctgcaccatcgtg
ctgggcacctttgccatccagatagtgatcgtgcagtttgggggaaagccgttcagctgc
tcgccgctgcagctggaccagtggatgtggtgcatcttcattgggctaggagagctcgtc
tggggccaagtcatcgccaccatcccaaccagcagactcaagttcctcaaggaggcagga
aggctgacacagaaagaggagatccccgaggaggagctgaacgaggacgtggaggagata
gaccacgcagagagagagctgcggcggggccagatcctgtggttccgaggcctgaatcgg
atccaaacgcagatccgcgtcgtgaaggcgttccgtagctctctctatgaaggtttagaa
aagcctgagtctcgaacctccatccataatttcatggctcatcccgaattccggatcgaa
gattcccagccccacatccccctcatcgacgacaccgacctggaagaagatgctgcgctc
aagcagaactcgagcccgccgtcctcgctcaacaagaacaacagcgccatcgacagcggg
atcaacctgacgaccgacacaagcaaatcagctacctcttcaagtccagggagccccatc
cacagcctggagacgtcgctttag

KEGG   Loxodonta africana (African savanna elephant): 100656297
Entry
100656297         CDS       T04351                                 

Gene name
ATP2B4
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 4 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04925  Aldosterone synthesis and secretion
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656297 (ATP2B4)
   04024 cAMP signaling pathway
    100656297 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    100656297 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100656297 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656297 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    100656297 (ATP2B4)
   04972 Pancreatic secretion
    100656297 (ATP2B4)
   04978 Mineral absorption
    100656297 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100656297 (ATP2B4)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100656297 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 100656297
NCBI-ProteinID: XP_003410290
UniProt: G3T9E8
LinkDB
Position
Unknown
AA seq 1208 aa
MTNPSEHALAANSMVDSREGDFGCSVMDLRKLMELRSTDAMNQIHDHYGDVQNICTRLKT
SPVEGLSGNPADLEKRRQVFGQNLIPPKKSKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPPGGDNEQCGQGASTPEDEGEAEAGWIEGAAILFSVLIVVLVTAFNDWSKEKQFRGL
QSRIEQEQKFSIIRNGQIIQLPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGASEGDGEEKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDSEEKEKKAAKMPKKEKSVLQGKLTRLA
VQIGKAGLIMSAITVLILILYFVIDNFVIQQRPWLAECTPIYIQYFVKFFIIGVTVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGTRYHQIPSPDALVPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYHAVRSEVPEEKLYKVYTFNSVRKSMSTVIRTPTGGFRMYSKGASEIILRK
CNRILNKEGDAVPFKSKDRDEMVRTVIEPMACEGLRTICIAYREFNDAEPLWDNENEILT
ELTCIAVVGIEDPVRPEVPEAIAKCKRAGITVRMVTGDNINTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGDQRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLL
KRRPYGRHKPLISRTMMKNILGHGVYQLTVIFLLVFAGEKFFDIDSGRKAPLHSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGERNVFAGIFRNPIFCSVVLGTFVSQIIIVEFGGKPFS
CTGLTLSQWFWCLFIGIGELLWGQVISAIPTQSLKFLKEAGHGTTKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIKVVKAFHSSLHENIMKPANQNSIHDFMTHPEFAIDE
EGPRTPVLEEQEEENPEKIFKSGTRVFPIDDDEVTPYANKNNNAVDCNQMQIVDSHSDSP
LHSLETSV
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgacgaacccatcagaacatgccttggcggccaactcgatggttgacagccgtgaaggg
gactttggctgctcggtgatggacctgaggaagctcatggagctgcgttcgaccgatgca
atgaaccagattcatgaccactatggagatgtacagaatatctgcactagactgaaaacc
tcccccgtggaaggtctatctgggaaccctgcggatctggagaaacgtaggcaagtgttt
ggccagaacttgattccccccaaaaagtccaagaccttcttagaattagtgtgggaagcc
cttcaagatgtcacacttatcatcctggagatcgcagccatcatctccctggtcctgtcc
ttctaccgcccccctggtggagacaacgaacaatgtgggcaaggcgcaagtaccccagaa
gatgaaggggaagcagaagccggctggatcgagggggcggccatcctgttctcagtgctc
atcgtggtgctagtgactgccttcaatgattggagcaaagagaagcaatttcggggcttg
cagagccgcattgaacaggagcaaaaattctccattatccgaaatggccagatcatccaa
cttcctgtggctgagatcgtggtgggtgacatcgcccaaatcaaatatggtgacctgctg
cctgcagatgggatcctgatccaggggaatgatctgaagattgacgagagctctctgact
ggggagtcagatcatgtcaagaagtccttggacaaagaccccatgctgctctcagggacc
catgtcatggaaggttctggccgaatggtagtgactgctgttggtgtcaactcccagacc
ggaatcatctttaccctcttaggggccagtgagggagatggggaggagaagaagaagaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaagacccaggatggagtggcc
ctggagatccaaccactcaatagccaggaagggatcgacagtgaggaaaaggagaaaaag
gcagcaaagatgcccaaaaaggagaaatcagtgctgcagggcaagctgacgcgcttggct
gtccagatcgggaaagctggtttgatcatgtcagctatcacggttctcatcctgattctc
tactttgtgattgacaacttcgtgatacagcagaggccatggctagctgagtgcacgccc
atctacatccagtactttgtcaagttcttcatcatcggcgtcactgtgctggtggtggct
gtgccagaggggctgccactggctgtcaccatctcactggcctactctgtgaagaaaatg
atgaaagacaacaacctagtgcggcacttggatgcgtgtgagaccatgggcaatgccaca
gccatttgctctgacaagactggcacattgaccatgaaccgcatgactgtggtacaggcc
tatattggtggcactcgctaccatcagatcccaagtcctgacgccctcgtgcccaaggtc
ctggaccttattgtcaatggcatttctatcaacagtgcctatacctccaagattttgcct
ccagagaaggagggaggcctgcctcggcaggtgggtaacaagactgagtgtgcgctgctg
ggctttgtcacagacctgaagcaggattaccacgcggtgcgcagtgaggtacctgaggag
aagctctataaagtgtataccttcaactcggtgcgcaagtccatgagtacagtcattagg
acgcccaccggcggcttccgcatgtacagcaagggcgcctccgagatcatcttacgcaag
tgtaatcgaatcctgaacaaggaaggggatgcagtgcctttcaagagcaaggaccgcgat
gagatggtgcgcactgtcattgagcccatggcctgtgaggggctccggaccatctgcata
gcttaccgggagttcaatgatgcagagcccttatgggacaatgagaatgaaatccttact
gagctcacctgcattgcagtggtgggcatcgaggaccccgtgcgcccagaggtgccagaa
gcaattgccaaatgcaaacgagctggcattactgtcagaatggtgaccggtgacaacatc
aacacagctcgggccatcgccaccaaatgtggcattctgacacctggggatgacttcctg
tgcttagaaggcaaagaattcaaccgactcatccgcaacgagaagggcgaggtagagcaa
gaaaagctcgacaagatctggcctaagcttcgagtcctggcgcgatcttcccccactgac
aagcacacactggtgaaaggcatcattgacagcactgtgggggatcagcggcaggtggtg
gctgtcactggtgatggcacaaatgacgggccagctctgaagaaagcagacgttggtttt
gccatgggtattgcaggcacagatgtagcaaaggaggcatcagatatcatcctgacagat
gacaacttcaccagcattgtgaaggcagtgatgtggggacgaaatgtttacgacagcatc
tccaagttccttcagttccagctcactgtgaacgtggtggccgtgatcgtggccttcact
ggagcttgtatcactcaggattctccattgaaagctgtgcagatgctgtgggttaatcta
atcatggacacttttgcctcattggccctggccacagagcctccgacagactctttgttg
aagcgtcgcccctacggccgacataagcctctgatctcacgtactatgatgaagaacatc
ttgggtcatggagtctatcagctcactgtcatctttctccttgtctttgctggtgagaaa
ttctttgacattgacagtggccgaaaggcacctctacactcaccacccagccaacactac
accatcgttttcaacaccttcgtgctgatgcagctcttcaatgaaatcaactcccgcaag
atccacggagagaggaatgtctttgcaggcatcttccgcaaccccatcttctgctctgtg
gtcttgggcacattcgtcagccagattatcattgtggaatttgggggcaagcccttcagt
tgcacagggctcaccctgtcccagtggttctggtgtctcttcatcgggattggagagctg
ctgtggggccaggtaatctctgcgatacctacccaatccctgaagttcctgaaggaggct
gggcatggcaccaccaaagaggaaatcaccaaggatgctgaggggctggatgagattgac
catgccgagatggagctgcgccgaggccagatcctttggttccggggcctgaaccgtatc
cagactcagatcaaagtggtcaaagcgttccatagttccctccatgaaaacattatgaaa
cctgcgaaccaaaactccatccatgacttcatgacccaccctgaattcgccatagacgag
gaggggccgcgaacgccagtcctggaggagcaagaggaggaaaaccctgaaaagattttt
aagtctgggacgagggtgttcccaattgatgacgacgaagtcacgccatatgccaacaaa
aacaacaacgcagtggattgcaaccaaatgcagattgttgactcccactcggacagccct
ctacacagcctggagacgtcagtttga

KEGG   Loxodonta africana (African savanna elephant): 100656362
Entry
100656362         CDS       T04351                                 

Gene name
ATP2B3
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04925  Aldosterone synthesis and secretion
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656362 (ATP2B3)
   04024 cAMP signaling pathway
    100656362 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    100656362 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100656362 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656362 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    100656362 (ATP2B3)
   04972 Pancreatic secretion
    100656362 (ATP2B3)
   04978 Mineral absorption
    100656362 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100656362 (ATP2B3)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100656362 (ATP2B3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 100656362
NCBI-ProteinID: XP_023396509
LinkDB
Position
Unknown
AA seq 1218 aa
MGDMANSSIEFYPKPQQQREAPHAGGFGCTLAELRSLMELRGAEALQKVQEAYGDVSGLC
RRLKTSPTEGLADNTTDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVVAGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVL
QGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFII
GVTVLVVAVPEGLPLAVTISLAYSVKVIKALTTIAVRMTWWWWLGLVPGPQGEWGGWMWA
PDAMGTLLALQPPEKEGALPRQVGNKTECALLGFVLDLKRDFQTVREQIPEDKLYKVYTF
NSVRKSMSTVICMPDGGFRLFSKGASEILLKKCSNILNSNGELRSFRPRDRDEMVKKIIE
PMACDGLRTICIAYRDFSAGQEPEWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQR
AGITVRMVTGDNINTARAIAVKCGIIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVW
PKLRVLARSSPTDKHTLVKGIIDSVTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGT
DVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQD
SPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPYGRDKPLISRTMMKNILGHAVYQ
LTIIFTLLFVGELFFDIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGERNV
FDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGFGELVWGQVIA
TIPTSQLKCLKEAGHGPGKDEMTDEELAEGEEEIDHAERELRRGQILWFRGLNRIQTQME
VVSTFKRSASFQGALRRRSSVLSQLHDVTNLSTPTHIRVVKAFRSSLYEGLEKPDSKASV
HNFMTTPEFLINDYTHNIPLIDDTDVDENEERLRAPPPQSPNKNNNAIDSGVYLATTASK
SATSSRPGSPLHSVETSL
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgggcgacatggccaacagctccatcgagttctaccccaaaccccagcagcagcgggag
gccccccatgcaggtggctttgggtgcacgctggccgagctgcgctccctcatggagctt
cgaggggccgaggccctgcagaaggtccaggaagcctatggggacgtcagtgggctctgc
agaaggctgaagacctcccccacggagggcctggcggacaacaccaccgaccttgagaag
cgcaggcagatctacgggcagaacttcatcccccccaagcagcccaagaccttcctgcag
ctggtgtgggaggcccttcaggacgtgactctcatcatcctggaggtggccgccattgtc
tccctgggcctctcgttctacgcaccaccgggagaggagagtgaggcctgcgggaacgtc
gtggccggggccgaagatgagggcgaggccgaggccggctggatcgagggcgccgccatt
ctgctgtcggtcatctgcgtggtgctggtcacggccttcaatgactggagcaaggagaag
cagttccgaggcctgcagagccgcattgagcaggagcagaaattcacagtcatccggaat
gggcagctcctgcaggtgccagtggccgcgctggtggtgggagacatcgctcaagtcaaa
tacggagacctgctgcctgctgacggcgtgctcatccagggcaacgacctcaagattgat
gagagctcactgactggagagtctgaccacgtgcgcaagtcggcagacaaagacccaatg
ctgctctcaggcactcatgtcatggaaggttccggaaggatggtggtgacagctgtgggg
gtgaattcccagacaggcatcatctttaccttgcttggagctggcggggaggaggaggag
aagaaggataagaaaggcaagcagcaggatggggcgatggagagtagccaaactaaagcc
aagaagcaggacggggccgttgccatggagatgcagcccctaaagagtgcagagggtggg
gagatggaggagcgggagaagaagaaagccaatgtgcccaagaaggagaagtcggtcctc
caggggaagctcacaaagctggccgtgcagatcgggaaagcggggctggtgatgtctgcc
atcactgtgatcatcctggtcctctactttgtcatcgaaacctttgtagtcgacggccgg
gtgtggctggctgagtgcacgccggtctacgtgcagtacttcgtgaagttcttcatcatc
ggggtcactgtgctggtcgtggccgtcccagagggcctgcctcttgctgtcaccatctcc
ttagcttactccgtcaaggtaataaaggcactaaccacaatagccgtaagaatgacctgg
tggtggtggctgggcttggtaccagggccccagggagagtggggaggatggatgtgggcc
cctgatgccatgggtactctcttggccttgcagcctccagagaaggaaggtgcccttcca
cgccaagtgggcaataaaacggagtgtgctctcctgggctttgtcctggacctcaagcgg
gacttccagacagtgcgagagcagattccagaagataagctttacaaagtgtacaccttc
aactcagtccgaaagtccatgagcacagtcatctgcatgcccgacggtggcttccgcctc
ttcagcaagggggcctcagagattctcctcaaaaagtgttccaacatcttaaatagcaac
ggtgaactccgcagcttccgtccgcgggaccgggatgagatggtgaagaagatcattgag
ccgatggcctgcgatggcctccgcaccatctgcattgcctaccgcgacttctccgcgggc
caggagcctgaatgggacaacgagaacgaggtcgtgggcgacctcacctgcatcgctgtg
gtgggcatcgaggaccctgtgcggccggaggtccctgaagctatccgcaagtgccagcgt
gctggcatcaccgtgcgcatggtgaccggggacaacatcaacactgcccgggccattgcg
gtcaagtgcggcatcatccagcctggggaggacttcctgtgcctggagggaaaggagttc
aaccggcggatccgcaacgagaagggcgagatagaacaggagcggctggacaaggtgtgg
cccaagttgagggttctcgcccgctcttctcccaccgacaagcacactctggtcaaaggg
attatcgacagcgtgaccggggagcagaggcaggtggtggctgtgaccggagatggcacc
aacgacgggccagctctcaagaaggctgacgtgggcttcgctatgggcatcgcagggaca
gatgtggccaaggaggcctctgacatcatcctgacagacgacaacttcaccagcattgtc
aaggcagtgatgtggggccgtaacgtctatgacagcatctccaagttcctgcagttccag
ttgacggttaacgtggtagcagtgattgtggccttcacaggggcctgcattactcaggac
tctcctctcaaagccgtgcagatgttgtgggtgaacttgatcatggacacatttgcctct
ctggccctggcaacggagccacccactgagtcattgctcctgcggaagccatacggccgg
gacaagcccctgatctcacgcaccatgatgaagaacatcctgggccatgcagtctaccag
ctcaccatcatcttcaccctgctctttgtcggggagctcttctttgacatcgacagcggg
aggaatgcacccctgcactcgccgccttctgagcactacaccatcattttcaacaccttc
gtcatgatgcagctcttcaatgagatcaatgcccgcaagatccacggggagaggaacgtc
ttcgacggcatcttcagcaaccccatcttctgcaccattgtcttgggcacctttggaatc
cagattgtcatcgttcagtttggtgggaaacccttcagctgctcccccctgtccacggaa
cagtggctctggtgcctgtttgttggttttggggagctggtctggggacaggtcatcgcc
accatccccaccagccaactcaagtgtctgaaggaggcagggcatgggcctgggaaggat
gagatgactgacgaggagctggccgagggggaggaagagattgaccacgccgagcgggag
ctccgtaggggccaaatcctttggttccgaggcctcaaccggatccagacacagatggag
gtagtgagtaccttcaagagaagcgcttcatttcagggtgccctgcgccggcggtcttca
gtcctcagccagctccatgacgtaaccaatctttctacccctactcacatccgggtggtg
aaagccttccgtagctcgctctacgagggcctggagaagccagactctaaggcctccgtc
cataacttcatgactacgcccgagttcctgatcaatgactacacccacaacatcccgctc
atcgatgacacggatgtagatgagaacgaggagcgcctgcgcgcccccccaccccagtcc
cccaacaagaacaacaacgccatagacagcggcgtctacctggccacgaccgccagcaag
tcagctacctcttccaggcccggaagccccctccacagcgtggagacgtcgctctaa

KEGG   Loxodonta africana (African savanna elephant): 100656553
Entry
100656553         CDS       T04351                                 

Gene name
ATP2B1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1 isoform X1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04925  Aldosterone synthesis and secretion
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04972  Pancreatic secretion
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100656553 (ATP2B1)
   04024 cAMP signaling pathway
    100656553 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    100656553 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100656553 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656553 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    100656553 (ATP2B1)
   04972 Pancreatic secretion
    100656553 (ATP2B1)
   04978 Mineral absorption
    100656553 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100656553 (ATP2B1)
Enzymes [BR:lav01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     100656553 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 100656553
NCBI-ProteinID: XP_010597526
UniProt: G3TEQ6
LinkDB
Position
Unknown
AA seq 1220 aa
MGDMANNSVSYGGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGNSALCGEVSLGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEDGGDSDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSFRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTMCLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCAIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPESRSS
IHNFMSHPEFRIEDSEPHIPLIDDTDAEDDAPTKRNPSPPPSPNKNNNAVDSGIHLTIEM
NKSATSSSPGSPLHSLETSL
NT seq 3663 nt   +upstreamnt  +downstreamnt
atgggcgatatggcaaacaactcagtttcatatggtggtgtgaaaaactctttgaaggaa
gctaatcatgatggagactttggaattaccctcgcggaactgcgagctctcatggagctc
agatccacagatgcattacggaaaatacaggaaagctatggagacgtctatggaatttgc
accaagttgaaaacatctcccaatgaaggtttaagtggaaatcctgcagatatagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacttttcttcaa
ttagtatgggaagcattacaagatgttactttaattatattagaaattgcagccatagta
tcactgggcctttctttttatcaacctccagaagggaatagtgcactttgtggagaagtt
tctcttggggaggaagaaggtgaaggtgaaactggttggattgaaggagctgcaatcctt
ttgtcagtagtgtgtgtggtattagtaacagctttcaatgactggagtaaggaaaaacag
ttcagaggtttgcagagtcgaattgaacaagaacagaagttcactgtcatcaggggtggt
caggtcattcagatacctgtagctgacattaccgttggggatattgctcaagtgaaatat
ggtgatcttcttccagctgacggcatacttattcaaggcaatgatcttaaaattgatgaa
agttcgttgactggtgaatctgatcacgttaagaagtcattagataaagaccctttactt
ttatcaggtactcatgtaatggaaggctctggaagaatggtagttacagctgtaggtgta
aattctcaaactggaattatctttaccttacttggagctggaggtgaagaggaagaaaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctatcgagaatcgc
aacaaagcaaaagcccaagatggtgcagccatggaaatgcagcctttgaagagtgaagac
ggtggagatagtgatgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaatcc
gttttacaggggaaacttacaaaactggctgttcagattggcaaagcaggtctgttgatg
tctgccatcacggttatcatcctagtattatattttgtaattgatacattctgggttcag
aagagaccatggcttgctgagtgtacaccgatttacatacaatattttgtgaagttcttc
attatcggagtcacagttttagtggtagcagtgccggaaggtcttccacttgcggtcact
atctcactggcttattcagtcaagaaaatgatgaaagataataacttggtaaggcatctg
gatgcttgtgaaaccatgggaaatgctacagccatttgttcagataaaacaggaacattg
acaatgaacaggatgacagttgtccaagcttacataaatgaaaaacattataaaaaggtt
cctgaacccgaagctattccaccaaatattctgtcctatctggtaacaggaatttctgtg
aactgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcat
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaaacgggattat
caggatgttagaaatgaaataccagaagaagcactgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcttgaaaaattcagatggaagttttcgaatattcagc
aagggtgcctctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtattcagaccaagggaccgtgatgatattgtaaaaactgtgattgaacctatg
gcatcggaaggcttgagaaccatgtgtcttgcattcagagatttcccagcaggagaacca
gaaccagagtgggataatgaaaatgatattgtcaccggcctcacatgcattgctgttgtg
ggaattgaagatcctgtgagacctgaggtaccagatgcaataaagaaatgccagagggct
ggaattactgtgcggatggttaccggtgataatattaatactgctcgggctattgctacc
aaatgtggcattttacaccctggggaagatttcctatgcctagaaggtaaagatttcaac
agaagaatacgaaatgaaaaaggagagattgagcaggagcggatagacaagatttggcca
aaacttcgagtacttgcaagatcatctcctactgacaaacatacactggttaaaggtata
attgacagcactgtctcagaacaacgccaggtggtagctgtaactggtgatggtacgaat
gatggcccggcactaaagaaagcagatgttggatttgcaatgggtattgctggaactgac
gtagctaaagaagcatctgatattattctcacagatgacaactttacgagcattgttaaa
gcagttatgtggggacgaaatgtctatgacagcatctcaaaattccttcagttccagctt
actgttaatgtagtagcagtgattgttgctttcacgggtgcctgtattactcaagattca
ccgcttaaggctgtgcagatgctgtgggtaaacctcataatggatacactcgcttccctg
gctctggcaactgaaccacccactgagtctctcttgcttcggaaaccttacggtagaaat
aagcctctcatctcacgcacgatgatgaagaatattttgggtcatgcattctatcaactt
gtggtagtctttacactcttatttgctggagaaaaattttttgatattgatagtggaaga
aatgctcctttgcatgctcctccttcggaacattatactattgtttttaataccttcgtg
ctgatgcaacttttcaatgaaataaatgcccggaaaattcatggcgaaagaaatgtgttt
gaaggaatctttaataatgccatcttctgcgcgattgttttagggacttttgtggtacag
ataataattgtgcagtttggtggaaaacctttcagttgttcagaactttcaatagaacag
tggctatggtcaatattcctaggaatgggaacgttactctggggccagcttatttcaaca
attccaactagccgtttaaaattcctaaaagaagctggtcatgggacacaaaaggaagaa
atacctgaggaagaattagcagaagatgttgaagaaattgatcatgcggaaagggagttg
cggcgtggccagatcttgtggtttagaggtctgaacagaatccagacacagattcgagtg
gtgaatgcatttcgtagttctttatatgaagggttagaaaaaccggaatcaagaagttcg
attcacaacttcatgtcacatcctgagtttaggatagaagattcagaaccccatatcccc
cttattgatgacactgatgctgaagatgatgctcctacaaaacgtaaccccagccctccg
ccctctcccaacaaaaacaacaacgccgttgacagcgggattcacctcaccatagaaatg
aacaagtctgctacctcttcatccccaggaagcccactacacagtttggaaacatcgctc
tga

DBGET integrated database retrieval system