KEGG   Loxodonta africana (African savanna elephant): 100655548
Entry
100655548         CDS       T04351                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100655548 (JAK1)
   04151 PI3K-Akt signaling pathway
    100655548 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100655548 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100655548 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100655548 (JAK1)
   04658 Th1 and Th2 cell differentiation
    100655548 (JAK1)
   04659 Th17 cell differentiation
    100655548 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100655548 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655548 (JAK1)
   05203 Viral carcinogenesis
    100655548 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100655548 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100655548 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100655548 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655548 (JAK1)
   05161 Hepatitis B
    100655548 (JAK1)
   05160 Hepatitis C
    100655548 (JAK1)
   05171 Coronavirus disease - COVID-19
    100655548 (JAK1)
   05164 Influenza A
    100655548 (JAK1)
   05162 Measles
    100655548 (JAK1)
   05168 Herpes simplex virus 1 infection
    100655548 (JAK1)
   05163 Human cytomegalovirus infection
    100655548 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655548 (JAK1)
   05169 Epstein-Barr virus infection
    100655548 (JAK1)
   05165 Human papillomavirus infection
    100655548 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100655548 (JAK1)
   05140 Leishmaniasis
    100655548 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100655548 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655548 (JAK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100655548 (JAK1)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100655548 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1
Other DBs
NCBI-GeneID: 100655548
NCBI-ProteinID: XP_010589628
LinkDB
Position
Unknown
AA seq 1123 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLPDREPLRLSSGEYTAEDL
CIKAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DSEHLVPAPKGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPEL
PKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYL
ATLETLTKHYGAEIFETSMLLISSENEMNRFHSNDSGNILYYEVMVTGNLGIQWRQKPNV
LPVEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSYFPEITHIVIKESVVSINKQDNKK
MELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPLIVHNIENGCHGPICTEYAIN
KLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKTEQVLGGQKQFKNFQIEVQKGHYSLHG
SDRSFPTLGELMGHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKAQEWQPVYTMS
QLSFDRILKKDIMQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKRIKVILKVLDPSHRDI
SLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRRSDALTTPWK
FKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLTRQE
CIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCR
PVTPSCKELADLMTHCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSERKPATEVDPTHFE
KRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRN
LYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGM
DYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPE
CLIQCKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEG
KRLPCPPNCPDEVYHLMRKCWEFQPSNRTTFQNLIEGFEALLK
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgcagtatctaaacataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagacagaggtgaatctggaggcccctgagccaggggtggaggtgatcttc
tatctgcctgatagggagcccctccggctgagcagtggagagtacacggcagaggacctg
tgcatcaaggctgcgcaggaatgctgtatctctcctctgtgtcacaacctctttgctctg
tacgatgagaacaccaagctctggtacgctccaaatcgcaccatcactgttgatgacaag
acgtcactccggctccactaccggatgaggttctatttcaccaactggcacgggaccaat
gacagtgagcatcttgtccctgctccaaagggacagtacgatttggtcaaatgcctggct
cccatccgagatcccaagacagagcaggatgggcatgatatcgagaatgagtgtctggga
atggctgtcttggccatctcacactatgccatgatgaagaagatgcagttgccagaactt
cccaaggacatcagctacaaacgatatattccagaaacattgaataagtccatcagacag
agaaatctcctcacaaggatgcgaataaataatgttttcaaggatttcctaaaggaattt
aacaacaagaccatttgtgatagcagtgtgtccacgcatgacctgaaggtgaaatacctg
gctaccttggaaactttgacaaaacattatggtgctgaaatatttgagacttccatgtta
ctgatttcatcagaaaatgaaatgaatcgatttcattcaaatgacagtggaaacattctc
tactatgaagtgatggtgactggcaacctcggaatccagtggcggcagaaaccaaacgtt
cttcctgttgaaaaggaaaaaaataaactgaagcggaaaaaactggaaaataaacacaag
aaggatgaggagaaaaacaaaatccgggaagagtggaacaacttttcttactttcctgaa
atcactcacattgtaataaaggagtctgtagtcagcattaacaagcaggacaacaaaaaa
atggaactgaagctctcttcccacgaggaggccttgtcctttgtgtctctggtagatggc
tactttcggctcacagcagatgcccatcattacctctgcactgatgtggctcccccattg
atcgtccacaacatagagaacggctgtcacggtccaatctgcacagaatatgccatcaac
aaattgcggcaagaaggaagtgaggaggggatgtatgtgctgaggtggagctgcaccgac
tttgacaacatcctcatgactgtcacctgctttgaaaaaactgagcaggtcctgggtggc
cagaaacagttcaagaactttcagatcgaggtacagaagggccactatagcctgcatggc
tcggaccgcagcttccccaccttgggagagctcatgggccacctcaagaagcagatcctg
cgcacagacaacatcagcttcgtgctgaaacgctgctgccagcccaagcctcgagaaatc
tccaatctgctggtagctaccaagaaagcccaggagtggcagcccgtctacaccatgagc
cagctgagtttcgatcggatcctcaaaaaggatattatgcaaggcgagcaccttgggaga
ggcacacggacacacatctactctgggaccctgatggattacaaggatgatgaaggaact
tctgaagagaagagaataaaagtgatcctcaaagtcttagaccccagccacagggacatt
tctctggcctttttcgaggcagccagcatgatgagacaggtctcccacaaacacatcgtg
tacctctatggtgtctgtgtccgagacgtggagaatatcatggtggaagagtttgtggag
ggggggcccctggatctcttcatgcaccggagaagtgatgccctcaccacaccatggaag
ttcaaagtcgccaaacagctggccagcgccctgagttacttggaggataaagacctggtc
catggaaacgtgtgcactaaaaacctcctcctggcccgtgagggcattgacagcgagtgt
ggcccattcatcaagctcagtgaccctggcatccccatcactgtgctgacccggcaagag
tgcatagaacgaattccatggattgctcctgagtgtgttgaagactccaagaacctgagc
gtggccgccgacaagtggagctttggaaccacactctgggaaatctgctacaatggcgag
atacccctgaaagacaagacactgattgagaaagaaagattttatgaaagccgatgcaga
ccagtaacgccatcctgtaaggagctggctgacctgatgacccactgcatgaactacgac
cccaaccagagacctttcttccgagctatcatgagagacattaataaacttgaagagcag
aatccagacattgtttcagaaagaaaaccagcaactgaggtggatcctacacactttgaa
aagcggttcttaaagaggatacgtgacttgggagagggccactttggaaaagttgagctt
tgcaggtatgaccctgaaggggacaatactggggagcaggtggctgtcaaatccctgaag
cctgagagtggaggcaaccacattgctgatctgaagaaggaaatagaaatcttaaggaac
ctctatcatgagaacattgtgaagtacaaagggatctgcacagaagatggaggaaatggt
attaagctcatcatggaatttctgccttctggaagccttaaggaatatcttccaaagaat
aagaacaaaatcaaccttaaacagcagctaaaatatgctgttcagatttgtaagggaatg
gactatttgggttctcggcaatatgttcaccgggatttagcagcaagaaatgtccttgtt
gagagtgaacaccaagtgaagattggagactttggcttaaccaaagcaattgaaactgac
aaggagtactacacagtcaaggatgatcgggatagccctgtgttttggtatgctccagaa
tgtttaattcaatgtaaattttacatcgcctctgatgtctggtcctttggagtgactctg
catgagctgctgacttactgtgattctgactccagtcccatggcgttgttcctgaaaatg
ataggcccaactcatggccagatgacagtaacgagacttgtgaatacattaaaagaagga
aaacgtttgccatgtccacctaactgccccgatgaggtttatcaccttatgagaaaatgc
tgggaattccaaccatccaatcggacaacttttcagaaccttattgaaggatttgaagca
cttttaaaataa

DBGET integrated database retrieval system