KEGG   Loxodonta africana (African savanna elephant): 100655555
Entry
100655555         CDS       T04351                                 

Gene name
KNG1
Definition
(RefSeq) kininogen-1
  KO
K03898  kininogen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04071  Sphingolipid signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04610  Complement and coagulation cascades
lav04750  Inflammatory mediator regulation of TRP channels
lav04810  Regulation of actin cytoskeleton
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100655555 (KNG1)
   04022 cGMP-PKG signaling pathway
    100655555 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100655555 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100655555 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100655555 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100655555 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655555 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100655555 (KNG1)
   05143 African trypanosomiasis
    100655555 (KNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100655555 (KNG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100655555 (KNG1)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I25: cystatin family
   100655555 (KNG1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100655555 (KNG1)
  Exosomal proteins of other cancer cells
   100655555 (KNG1)
SSDB
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 Bradykinin PMG Nudix_hydro
Other DBs
NCBI-GeneID: 100655555
NCBI-ProteinID: XP_003412956
LinkDB
Position
Unknown
AA seq 631 aa
MKLIAILFLCSRLLPSLTQEPFSTDIDCNNEEVFKAVDAALKKYNGQNQSGNQFVLYRIT
QVIKTESSGTFYSFKYEIKEGDCPVQSGKTWQDCDYKEASEAATGECTATVKRKDTKFIV
ATQTCQITPAEGPVVMKEYTCLGCDHPISTDSPDLEPVLRHAIEYFNNNTEHPYLFALQE
VKKAHRQVVAGWNYGITYSIVQTNCSKENFLFLTPDCKSLLNGDSGECRGIAYMDPQLRI
TSFTQNCDLHPEAEFVPPPTKICAGCPKEIAVDSPELEEALNHSIAKLNAESNETFYFKI
DSVKNATVQVVAGRKFSFTFIARETTCSKESNEELISSCETKEAGKVLECNADVHVVPWE
EKIYPTVNCQPLAMDSLRKRPPGFSPFRSVLWKPVGTGEVTTVSPPHTSMAPVQDEEQDP
GKEQHIRGHGWGLEKQIKRGVHGHKHKHDQGHGHQRGHGLGLGHQQPHGLGHGHQKRLGL
AHGHKHGHDHGKHKNKGKNNGKHNGWREEHLVSSPEGSTTPFIQAQEKTERPTPIPSLAQ
PDVVVTFSDFWDSDLIATVTPNTVPPPTENDDDWIPDIQVEPNSLSFNVIPDFPETTSPK
CPGRPWKPVNGMNPTVKVKEFHDFDLSDALS
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaaactaatcgccatcctcttcctctgctccaggctgctcccaagtttgacccaggaa
cccttctcaacggacattgactgtaacaacgaggaagttttcaaggctgtggatgctgca
ctgaagaaatataacggtcaaaaccaaagcggcaaccagtttgtattgtaccgtataacc
caggtcatcaagacggaaagctctggcacattttattccttcaagtacgaaatcaaggag
ggtgattgtcctgttcaaagtggcaaaacctggcaagactgtgactacaaagaagcttcg
gaagctgccacaggggaatgcacagcgacagtgaagaggaaagatacaaaattcatcgtt
gctacccagacctgccagattactccagccgagggccctgtagtgatgaaagagtacacc
tgccttggatgtgatcaccctatatcgacagacagccctgacctggagcctgttctgaga
cacgccattgagtactttaacaacaacactgagcacccctacctctttgctcttcaggaa
gtgaagaaggcccatagacaggtggtggctggatggaactatggaattacctactcaatt
gtgcaaactaattgttccaaggagaattttctattcttaactcctgactgcaagtccctt
ttgaatggtgattccggtgaatgtagaggcattgcgtacatggatcctcagctaagaatc
acttctttcacacagaactgtgaccttcacccagaagcggaatttgtaccaccacctacc
aagatttgtgctggctgtcccaaggagatagccgttgacagcccagagctggaggaggct
ttaaatcattccatcgcaaagcttaatgcagagagtaacgaaactttctatttcaagatt
gacagtgtgaaaaacgcaacagtacaggtggtggctggaaggaaattttcttttactttc
atagccagagaaaccacttgttccaaggaaagtaatgaagaattgatcagtagttgtgaa
accaaggaagctggaaaagttctagaatgcaatgctgacgttcacgtggtaccttgggag
gaaaaaatttaccctactgtcaactgccaaccgctggcaatggactcattgaggaaaagg
cctccaggtttttcacccttccgatcagtactatggaaaccggtgggaacaggagaagta
acaactgtaagtccaccccacacttccatggcacctgtacaagatgaagagcaggatcca
ggaaaagagcaacatattcgtgggcatggttggggccttgaaaagcaaataaaacgtggc
gtccatggccataaacataagcatgaccaaggccatgggcatcaaaggggacatggcctt
ggccttggacaccaacagccgcatggccttggtcatggacatcaaaaacgacttggccta
gcccatggacataaacatggacatgaccatggaaaacataaaaataaaggcaaaaacaat
ggaaagcacaatggttggagagaagagcatttggtaagctctcctgaagggagtactaca
ccttttatacaggcacaagagaagacagaaaggccaacacccatcccttccctagcccag
ccagatgtagtagttaccttttctgacttttgggactcagatctcattgcaactgtgaca
cctaatacagtaccacctcccacagagaatgatgatgactggatccctgacatccaagta
gaaccaaatagcctttcgtttaacgtgatacctgattttccagaaacaacctcccccaag
tgtcccggacgcccctggaagccagttaatggaatgaatccaaccgtgaaagtgaaagaa
tttcatgattttgatctctctgatgctctttcttaa

DBGET integrated database retrieval system